DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Acam and cam2

DIOPT Version :9

Sequence 1:NP_001163737.1 Gene:Acam / 44913 FlyBaseID:FBgn0011273 Length:148 Species:Drosophila melanogaster
Sequence 2:NP_594877.1 Gene:cam2 / 2542611 PomBaseID:SPAC29A4.05 Length:143 Species:Schizosaccharomyces pombe


Alignment Length:144 Identity:54/144 - (37%)
Similarity:88/144 - (61%) Gaps:4/144 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 TEEQIAEFKDAFVQFDKEGTGKIATRELGTLMRTLGQNPTEAELQDLIAEAENNNNGQLNFTEFC 69
            ::||..|.|:|||.:|.:..|.|.|..:|:::|:||.|.|:|||    |:..|.....::..:|.
pombe     4 SKEQTDEMKEAFVLYDIDKDGLIPTSHVGSVLRSLGINVTDAEL----AKLSNELGDAIDEKKFM 64

  Fly    70 GIMAKQMRETDTEEEMREAFKIFDRDGDGFISPAELRFVMINLGEKVTDEEIDEMIREADFDGDG 134
            ..::.::|||::|||..:||::||:|..|:|..|:....|..||||::|.|:..|::|||....|
pombe    65 SFVSNKLRETESEEEYIKAFRVFDKDNSGYIETAKFADYMKTLGEKLSDNEVQLMVQEADPTNSG 129

  Fly   135 MINYEEFVWMISQK 148
            ..:|.:||..|..|
pombe   130 SFDYYDFVQRIMAK 143

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AcamNP_001163737.1 PTZ00184 3..148 CDD:185504 53/142 (37%)
EFh 11..73 CDD:238008 21/61 (34%)
EFh 84..146 CDD:238008 24/61 (39%)
cam2NP_594877.1 FRQ1 1..143 CDD:227455 53/142 (37%)
EFh 10..105 CDD:298682 35/98 (36%)
EFh 79..141 CDD:238008 24/61 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23050
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.