DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Acam and Calm3

DIOPT Version :9

Sequence 1:NP_001163737.1 Gene:Acam / 44913 FlyBaseID:FBgn0011273 Length:148 Species:Drosophila melanogaster
Sequence 2:NP_036650.1 Gene:Calm3 / 24244 RGDID:2259 Length:149 Species:Rattus norvegicus


Alignment Length:146 Identity:98/146 - (67%)
Similarity:126/146 - (86%) Gaps:0/146 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 ELTEEQIAEFKDAFVQFDKEGTGKIATRELGTLMRTLGQNPTEAELQDLIAEAENNNNGQLNFTE 67
            :||||||||||:||..|||:|.|.|.|:||||:||:||||||||||||:|.|.:.:.||.::|.|
  Rat     4 QLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPE 68

  Fly    68 FCGIMAKQMRETDTEEEMREAFKIFDRDGDGFISPAELRFVMINLGEKVTDEEIDEMIREADFDG 132
            |..:||::|::||:|||:||||::||:||:|:||.||||.||.|||||:||||:||||||||.||
  Rat    69 FLTMMARKMKDTDSEEEIREAFRVFDKDGNGYISAAELRHVMTNLGEKLTDEEVDEMIREADIDG 133

  Fly   133 DGMINYEEFVWMISQK 148
            ||.:||||||.|::.|
  Rat   134 DGQVNYEEFVQMMTAK 149

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AcamNP_001163737.1 PTZ00184 3..148 CDD:185504 97/144 (67%)
EFh 11..73 CDD:238008 37/61 (61%)
EFh 84..146 CDD:238008 46/61 (75%)
Calm3NP_036650.1 PTZ00184 1..149 CDD:185504 97/144 (67%)
Necessary and sufficient for interaction with PCP4. /evidence=ECO:0000250|UniProtKB:P0DP25 77..149 51/71 (72%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BAEQ
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23050
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X199
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.910

Return to query results.
Submit another query.