DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Acam and Tnnc1

DIOPT Version :9

Sequence 1:NP_001163737.1 Gene:Acam / 44913 FlyBaseID:FBgn0011273 Length:148 Species:Drosophila melanogaster
Sequence 2:NP_033419.1 Gene:Tnnc1 / 21924 MGIID:98779 Length:161 Species:Mus musculus


Alignment Length:148 Identity:59/148 - (39%)
Similarity:101/148 - (68%) Gaps:8/148 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSELTEEQIAEFK---DAFVQFDKEGTGKIATRELGTLMRTLGQNPTEAELQDLIAEAENNNNGQ 62
            :.:|||||..|||   |.||...::|.  |:|:|||.:||.||||||..|||::|.|.:.:.:|.
Mouse     9 VEQLTEEQKNEFKAAFDIFVLGAEDGC--ISTKELGKVMRMLGQNPTPEELQEMIDEVDEDGSGT 71

  Fly    63 LNFTEFCGIMAKQMRETD---TEEEMREAFKIFDRDGDGFISPAELRFVMINLGEKVTDEEIDEM 124
            ::|.||..:|.:.|::..   :|||:.:.|::||::.||:|...||:.::...||.:|:::|:|:
Mouse    72 VDFDEFLVMMVRCMKDDSKGKSEEELSDLFRMFDKNADGYIDLDELKMMLQATGETITEDDIEEL 136

  Fly   125 IREADFDGDGMINYEEFV 142
            :::.|.:.||.|:|:||:
Mouse   137 MKDGDKNNDGRIDYDEFL 154

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AcamNP_001163737.1 PTZ00184 3..148 CDD:185504 59/146 (40%)
EFh 11..73 CDD:238008 29/64 (45%)
EFh 84..146 CDD:238008 21/59 (36%)
Tnnc1NP_033419.1 PTZ00184 9..157 CDD:185504 59/148 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.