DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Acam and cal-5

DIOPT Version :9

Sequence 1:NP_001163737.1 Gene:Acam / 44913 FlyBaseID:FBgn0011273 Length:148 Species:Drosophila melanogaster
Sequence 2:NP_508864.2 Gene:cal-5 / 192083 WormBaseID:WBGene00006861 Length:156 Species:Caenorhabditis elegans


Alignment Length:148 Identity:49/148 - (33%)
Similarity:84/148 - (56%) Gaps:7/148 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSELTEEQIAEFKDAFVQFDKEGTGKIATRELGTLMRTLGQNPTEAELQDLIAEAENNNNGQLNF 65
            :.|:.|:   :.|..|.:||..|.|.|...||..:|:.:||:|||.||..:...|:.:.:|.::|
 Worm    15 VGEIRED---DLKGIFREFDLNGDGYIQREELRAVMQKMGQSPTEDELDAMFQAADKDCDGNIDF 76

  Fly    66 TEFCGIMAKQMRETDTEEEMREAFKIFDRDGDGFISPAELRFVMINLGEKVTDEEIDEMIREADF 130
            .||. ::||   .......::..|:..|.||||:|:.:|||.....:|..::|::|..:.|..|.
 Worm    77 QEFL-VIAK---ANPLSLSLKAVFEELDVDGDGYITRSELRTAFQRMGHSLSDQDIKAIYRHVDQ 137

  Fly   131 DGDGMINYEEFVWMISQK 148
            :.||.||::||..|:::|
 Worm   138 NNDGKINFQEFCEMMTRK 155

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AcamNP_001163737.1 PTZ00184 3..148 CDD:185504 48/144 (33%)
EFh 11..73 CDD:238008 22/61 (36%)
EFh 84..146 CDD:238008 22/61 (36%)
cal-5NP_508864.2 PTZ00184 22..155 CDD:185504 46/136 (34%)
EFh 22..84 CDD:238008 22/62 (35%)
EFh 92..153 CDD:238008 22/60 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23050
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.