DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Acam and cal-2

DIOPT Version :9

Sequence 1:NP_001163737.1 Gene:Acam / 44913 FlyBaseID:FBgn0011273 Length:148 Species:Drosophila melanogaster
Sequence 2:NP_495906.2 Gene:cal-2 / 182789 WormBaseID:WBGene00000286 Length:171 Species:Caenorhabditis elegans


Alignment Length:138 Identity:71/138 - (51%)
Similarity:104/138 - (75%) Gaps:1/138 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LTEEQIAEFKDAFVQFDKEGTGKIATRELGTLMRTLGQNPTEAELQDLIAEAENNNNGQLNFTEF 68
            |.||:|.|:|.||..|||:|.|.|:::|||..||:|||||||.||.|::.|.:.:.:|.::|.||
 Worm    29 LNEEEIMEYKAAFRLFDKDGNGSISSKELGVAMRSLGQNPTEQELLDMVNEVDIDGSGTIDFGEF 93

  Fly    69 CGIMAKQMRETDTEEEMREAFKIFDRDGDGFISPAELRFVMINLGEKVTDEEIDEMIREADFDGD 133
            |.:|.:..:|.|: |.:||||::|||||:|||:..|.|:.|.::|::.:|:|:||:|.|.|.|||
 Worm    94 CQMMKRMNKENDS-EMIREAFRVFDRDGNGFITADEFRYFMTHMGDQFSDQEVDEIIAEIDIDGD 157

  Fly   134 GMINYEEF 141
            |.|:||||
 Worm   158 GQIDYEEF 165

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AcamNP_001163737.1 PTZ00184 3..148 CDD:185504 71/138 (51%)
EFh 11..73 CDD:238008 31/61 (51%)
EFh 84..146 CDD:238008 32/58 (55%)
cal-2NP_495906.2 PTZ00184 27..165 CDD:185504 69/136 (51%)
EFh 36..98 CDD:238008 31/61 (51%)
EFh 108..166 CDD:238008 32/58 (55%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23050
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
43.970

Return to query results.
Submit another query.