DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Acam and E02A10.3

DIOPT Version :9

Sequence 1:NP_001163737.1 Gene:Acam / 44913 FlyBaseID:FBgn0011273 Length:148 Species:Drosophila melanogaster
Sequence 2:NP_001343832.1 Gene:E02A10.3 / 179722 WormBaseID:WBGene00008453 Length:283 Species:Caenorhabditis elegans


Alignment Length:142 Identity:53/142 - (37%)
Similarity:89/142 - (62%) Gaps:1/142 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 TEEQIAEFKDAFVQFDKEGTGKIATRELGTLMRTLGQNPTEAELQDLIAEAENNNNGQLNFTEFC 69
            :||::.|::..|..||.:.:|.||..||...::.||...|..||..:|.|.:...|.|::|.|||
 Worm   132 SEEELQEYRQVFNMFDADRSGAIAIDELEAAIKNLGLEQTRDELDKIIDEVDQRGNHQIDFDEFC 196

  Fly    70 GIMAK-QMRETDTEEEMREAFKIFDRDGDGFISPAELRFVMINLGEKVTDEEIDEMIREADFDGD 133
            .:|.: .|::::..|.::|.|.:|||..:|.||..:.||::..||:...::.|||:..|||.||:
 Worm   197 VVMRRLTMKKSNWNEVVKECFTVFDRSENGGISKKDFRFILRELGDITDNQIIDEIFNEADVDGN 261

  Fly   134 GMINYEEFVWMI 145
            |:|:|:||.:|:
 Worm   262 GVIDYDEFTYMV 273

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AcamNP_001163737.1 PTZ00184 3..148 CDD:185504 53/142 (37%)
EFh 11..73 CDD:238008 22/61 (36%)
EFh 84..146 CDD:238008 26/62 (42%)
E02A10.3NP_001343832.1 EFh_PEF 132..273 CDD:330173 52/140 (37%)
EF-hand motif 140..167 CDD:320054 8/26 (31%)
EF-hand motif 175..203 CDD:320054 10/27 (37%)
EF-hand motif 208..241 CDD:320054 11/32 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.