DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Acam and cal-1

DIOPT Version :9

Sequence 1:NP_001163737.1 Gene:Acam / 44913 FlyBaseID:FBgn0011273 Length:148 Species:Drosophila melanogaster
Sequence 2:NP_001256428.1 Gene:cal-1 / 179715 WormBaseID:WBGene00000285 Length:180 Species:Caenorhabditis elegans


Alignment Length:148 Identity:77/148 - (52%)
Similarity:115/148 - (77%) Gaps:1/148 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSELTEEQIAEFKDAFVQFDKEGTGKIATRELGTLMRTLGQNPTEAELQDLIAEAENNNNGQLNF 65
            :.:||.|:|.||::||:.|||:|.|.|:|:|||..||:|||||||.|:.::|.|.:.:.|||:.|
 Worm    34 IKQLTPEEIDEFREAFMMFDKDGNGTISTKELGIAMRSLGQNPTEQEILEMINEVDIDGNGQIEF 98

  Fly    66 TEFCGIMAKQMRETDTEEEMREAFKIFDRDGDGFISPAELRFVMINLGEKVTDEEIDEMIREADF 130
            .|||.:|.:.|:|||: |.:||||::||:||:|.|:..|.|:.|:::|.:.::||:||||:|.|.
 Worm    99 PEFCVMMKRMMKETDS-EMIREAFRVFDKDGNGVITAQEFRYFMVHMGMQFSEEEVDEMIKEVDV 162

  Fly   131 DGDGMINYEEFVWMISQK 148
            ||||.|:|||||.|:|.:
 Worm   163 DGDGEIDYEEFVKMMSNQ 180

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AcamNP_001163737.1 PTZ00184 3..148 CDD:185504 77/144 (53%)
EFh 11..73 CDD:238008 33/61 (54%)
EFh 84..146 CDD:238008 33/61 (54%)
cal-1NP_001256428.1 EFh_PEF 36..177 CDD:330173 75/141 (53%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23050
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X199
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
54.970

Return to query results.
Submit another query.