DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Acam and Cabp1

DIOPT Version :9

Sequence 1:NP_001163737.1 Gene:Acam / 44913 FlyBaseID:FBgn0011273 Length:148 Species:Drosophila melanogaster
Sequence 2:NP_001028848.1 Gene:Cabp1 / 171051 RGDID:620385 Length:350 Species:Rattus norvegicus


Alignment Length:149 Identity:64/149 - (42%)
Similarity:95/149 - (63%) Gaps:5/149 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LTEEQIAEFKDAFVQFDKEGTGKIATRELGTLMRTLGQNPTEAELQDLIAEAENNNNGQLNFTEF 68
            |..|:|.|.::||.:|||:..|.|..|:||..|||:|..|||.||.:|..:...|..|.::|.:|
  Rat   202 LRPEEIEELREAFREFDKDKDGYINCRDLGNCMRTMGYMPTEMELIELSQQINMNLGGHVDFDDF 266

  Fly    69 CGIMA-KQMRETDT---EEEMREAFKIFDRDGDGFISPAELRFVMIN-LGEKVTDEEIDEMIREA 128
            ..:|. |.:.||..   .:|:|:||:.||.:|||.||.:|||..|.. ||.:|...:|:|:||:.
  Rat   267 VELMGPKLLAETADMIGVKELRDAFREFDTNGDGEISTSELREAMRKLLGHQVGHRDIEEIIRDV 331

  Fly   129 DFDGDGMINYEEFVWMISQ 147
            |.:|||.:::||||.|:|:
  Rat   332 DLNGDGRVDFEEFVRMMSR 350

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AcamNP_001163737.1 PTZ00184 3..148 CDD:185504 64/149 (43%)
EFh 11..73 CDD:238008 25/61 (41%)
EFh 84..146 CDD:238008 31/62 (50%)
Cabp1NP_001028848.1 PTZ00184 201..348 CDD:185504 62/145 (43%)
EFh 209..312 CDD:238008 43/102 (42%)
EFh 286..349 CDD:238008 31/62 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.