DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Acam and CALML6

DIOPT Version :9

Sequence 1:NP_001163737.1 Gene:Acam / 44913 FlyBaseID:FBgn0011273 Length:148 Species:Drosophila melanogaster
Sequence 2:XP_005244786.2 Gene:CALML6 / 163688 HGNCID:24193 Length:203 Species:Homo sapiens


Alignment Length:148 Identity:61/148 - (41%)
Similarity:95/148 - (64%) Gaps:2/148 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSE-LTEEQIAEFKDAFVQFDKEGTGKIATRELGTLMRTLGQNPTEAELQDLIAEAENNNNGQLN 64
            |:| |:.|||.|:|..|..||:||.|::.|.||..||..||.|||::||..:..:.:.:|.|..|
Human    48 MTERLSAEQIKEYKGVFEMFDEEGNGEVKTGELEWLMSLLGINPTKSELASMAKDVDRDNKGFFN 112

  Fly    65 FTEFCGIMAKQMRETDTEE-EMREAFKIFDRDGDGFISPAELRFVMINLGEKVTDEEIDEMIREA 128
            ...|..:|.....:...:| |:|.||::||::|.|:|....|::|::|.||.:.:.|.::|::||
Human   113 CDGFLALMGVYHEKAQNQESELRAAFRVFDKEGKGYIDWNTLKYVLMNAGEPLNEVEAEQMMKEA 177

  Fly   129 DFDGDGMINYEEFVWMIS 146
            |.|||..|:|||||.|::
Human   178 DKDGDRTIDYEEFVAMMT 195

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AcamNP_001163737.1 PTZ00184 3..148 CDD:185504 60/146 (41%)
EFh 11..73 CDD:238008 24/61 (39%)
EFh 84..146 CDD:238008 29/61 (48%)
CALML6XP_005244786.2 PTZ00184 48..195 CDD:185504 61/146 (42%)
EFh 59..120 CDD:238008 24/60 (40%)
EFh 133..195 CDD:238008 29/61 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23050
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.