DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Acam and MYL6B

DIOPT Version :10

Sequence 1:NP_476988.1 Gene:Acam / 44913 FlyBaseID:FBgn0011273 Length:148 Species:Drosophila melanogaster
Sequence 2:NP_002466.1 Gene:MYL6B / 140465 HGNCID:29823 Length:208 Species:Homo sapiens


Alignment Length:145 Identity:56/145 - (38%)
Similarity:92/145 - (63%) Gaps:7/145 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 ELTEEQIAEFKDAFVQFDKEGTGKIATRELGTLMRTLGQNPTEAELQDLIAEAENN--NNGQLNF 65
            |..::|:.|||:||..||:.|.|||...:.|.:||.||||||.||:..::...:::  .:.:::|
Human    60 EFNKDQLEEFKEAFELFDRVGDGKILYSQCGDVMRALGQNPTNAEVLKVLGNPKSDELKSRRVDF 124

  Fly    66 TEFCGIM---AKQMRETDTEEEMREAFKIFDRDGDGFISPAELRFVMINLGEKVTDEEIDEMIRE 127
            ..|..::   ||. |...|.|:..|.|::||::|:|.:..||||.|:..||||:|:||::.::..
Human   125 ETFLPMLQAVAKN-RGQGTYEDYLEGFRVFDKEGNGKVMGAELRHVLTTLGEKMTEEEVETVLAG 188

  Fly   128 ADFDGDGMINYEEFV 142
            .: |.:|.||||.|:
Human   189 HE-DSNGCINYEAFL 202

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AcamNP_476988.1 PTZ00184 3..148 CDD:185504 56/145 (39%)
MYL6BNP_002466.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..51
PTZ00184 58..207 CDD:185504 56/145 (39%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.