DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Acam and LOC1276848

DIOPT Version :10

Sequence 1:NP_476988.1 Gene:Acam / 44913 FlyBaseID:FBgn0011273 Length:148 Species:Drosophila melanogaster
Sequence 2:XP_316246.4 Gene:LOC1276848 / 1276848 VectorBaseID:AGAMI1_001165 Length:154 Species:Anopheles gambiae


Alignment Length:35 Identity:9/35 - (25%)
Similarity:15/35 - (42%) Gaps:6/35 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   232 AIAKDQLEIPAYITEYDMATNGIHYFQPITNTSSP 266
            ::.:|.:| |..::.|..     .|.||..|...|
Mosquito    59 SLIEDNME-PPMLSSYTR-----QYSQPYPNRCKP 87

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AcamNP_476988.1 PTZ00184 3..148 CDD:185504
LOC1276848XP_316246.4 PTZ00184 5..152 CDD:185504 9/35 (26%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.