DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Acam and cabp7a

DIOPT Version :10

Sequence 1:NP_476988.1 Gene:Acam / 44913 FlyBaseID:FBgn0011273 Length:148 Species:Drosophila melanogaster
Sequence 2:XP_017211721.1 Gene:cabp7a / 100329495 ZFINID:ZDB-GENE-101112-4 Length:215 Species:Danio rerio


Alignment Length:69 Identity:34/69 - (49%)
Similarity:48/69 - (69%) Gaps:0/69 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    80 DTEEEMREAFKIFDRDGDGFISPAELRFVMINLGEKVTDEEIDEMIREADFDGDGMINYEEFVWM 144
            |..||:|||||:|||||:||||..||...|.:||....:.|::.:|:..|.||||.:::||||.:
Zfish    33 DEVEEIREAFKVFDRDGNGFISKQELGMAMRSLGYMPNEVELEVIIQRLDMDGDGQVDFEEFVTL 97

  Fly   145 ISQK 148
            :..|
Zfish    98 LGPK 101

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AcamNP_476988.1 PTZ00184 3..148 CDD:185504 33/67 (49%)
cabp7aXP_017211721.1 PTZ00184 27..>102 CDD:185504 34/69 (49%)
EFh_PI-PLC 38..182 CDD:333715 31/64 (48%)
EF-hand motif 38..66 CDD:320029 17/27 (63%)
EF-hand motif 73..102 CDD:320029 12/29 (41%)
EF-hand motif 109..145 CDD:320029
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.