DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment unc-45 and SGT2

DIOPT Version :10

Sequence 1:NP_524796.1 Gene:unc-45 / 44910 FlyBaseID:FBgn0288846 Length:947 Species:Drosophila melanogaster
Sequence 2:NP_014649.1 Gene:SGT2 / 854168 SGDID:S000005533 Length:346 Species:Saccharomyces cerevisiae


Alignment Length:150 Identity:45/150 - (30%)
Similarity:68/150 - (45%) Gaps:31/150 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 NSEEVSDAGSYKDKGNEAFKASRWEEAVEHYGKAIKAGSKHKELAVFYKNRAAAYLKLGKYENAV 70
            ::|..:.|...|.:||:|.....:|.|:..|.:|||....:   |::|.|||||:..|.:|:.||
Yeast    95 DAETKAKAEDLKMQGNKAMANKDYELAINKYTEAIKVLPTN---AIYYANRAAAHSSLKEYDQAV 156

  Fly    71 EDCTESLKAAPGDPK----------ALFRRAQAYEALEKFEEAYK--------DATALFKAD--P 115
            :|...::..   ||.          |.:.:.:..|||    ||||        :||...|.|  .
Yeast   157 KDAESAISI---DPSYFRGYSRLGFAKYAQGKPEEAL----EAYKKVLDIEGDNATEAMKRDYES 214

  Fly   116 GNKTVQPMLQRLHVVVEERS 135
            ..|.|:..| .|...|.|:|
Yeast   215 AKKKVEQSL-NLEKTVPEQS 233

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
unc-45NP_524796.1 3a0801s09 7..>127 CDD:273380 41/139 (29%)
TPR repeat 16..41 CDD:276809 8/24 (33%)
TPR repeat 46..79 CDD:276809 12/32 (38%)
UNC45-central 351..494 CDD:432011
PLN03200 399..>700 CDD:215629
armadillo repeat 753..789 CDD:293788
armadillo repeat 795..826 CDD:293788
SGT2NP_014649.1 SGTA_dimer 7..71 CDD:465168
NlpI 41..221 CDD:443815 40/135 (30%)
TPR repeat 102..130 CDD:276809 9/27 (33%)
TPR repeat 135..165 CDD:276809 12/32 (38%)
TPR repeat 170..198 CDD:276809 8/31 (26%)
STI1 264..298 CDD:128966
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.