DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment unc-45 and Tomm34

DIOPT Version :9

Sequence 1:	NP_001303425.1	Gene:	unc-45 / 44910	FlyBaseID:	FBgn0010812	Length:	947	Species:	Drosophila melanogaster
Sequence 2:	NP_001278084.1	Gene:	Tomm34 / 67145	MGIID:	1914395	Length:	309	Species:	Mus musculus

Alignment Length:	120	Identity:	41/120 - (34%)
Similarity:	72/120 - (60%)	Gaps:	3/120 - (2%)

- Green bases have known domain annotations that are detailed below.

  Fly     9 EVSDAGSYKDKGNEAFKASRWEEAVEHYGKAIKAGSKHKELAVFYKNRAAAYLKLGKYENAVEDC 73
            :|..|.:.|::||:..|....::|:|.|.:::...|..   :..|.|||..:|.|.:|:.||:||
Mouse   189 DVERAKALKEEGNDLVKKGNHKKAIEKYSESLLCSSLE---SATYSNRALCHLVLKQYKEAVKDC 250

  Fly    74 TESLKAAPGDPKALFRRAQAYEALEKFEEAYKDATALFKADPGNKTVQPMLQRLH 128
            ||:||....:.||.:||||||:||:.::.:..|.::|.:.:|.|...|.:.|.::
Mouse   251 TEALKLDGKNVKAFYRRAQAYKALKDYKSSLSDISSLLQIEPRNGPAQKLRQEVN 305

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
unc-45	NP_001303425.1	TPR_11	12..81	CDD:290150	24/68 (35%)
		TPR repeat	16..41	CDD:276809	7/24 (29%)
		TPR repeat	46..79	CDD:276809	14/32 (44%)
		TPR_11	50..115	CDD:290150	27/64 (42%)
		TPR	50..83	CDD:197478	15/32 (47%)
		UNC45-central	351..494	CDD:288539
		ARM	668..788	CDD:237987
		armadillo repeat	753..789	CDD:293788
		armadillo repeat	795..826	CDD:293788
Tomm34	NP_001278084.1	TPR 3	85..118
		TPR repeat	85..113	CDD:276809
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	158..189		41/120 (34%)
		TPR_11	192..257	CDD:290150	24/67 (36%)
		TPR 4	193..226		9/32 (28%)
		TPR repeat	193..221	CDD:276809	8/27 (30%)
		TPR repeat	226..256	CDD:276809	14/32 (44%)
		TPR 5	227..260		15/32 (47%)
		TPR_1	229..260	CDD:278916	15/30 (50%)
		TPR 6	261..294		13/32 (41%)
		TPR 1	9..42
		TPR repeat	9..37	CDD:276809
		TPR_11	10..82	CDD:290150
		TPR_11	50..115	CDD:290150
		TPR repeat	50..80	CDD:276809
		TPR 2	51..84
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	1	0.930	-	-		C167846136
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	2	1.840