DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment unc-45 and SGTA

DIOPT Version :9

Sequence 1:	NP_001303425.1	Gene:	unc-45 / 44910	FlyBaseID:	FBgn0010812	Length:	947	Species:	Drosophila melanogaster
Sequence 2:	NP_003012.1	Gene:	SGTA / 6449	HGNCID:	10819	Length:	313	Species:	Homo sapiens

Alignment Length:	141	Identity:	53/141 - (37%)
Similarity:	72/141 - (51%)	Gaps:	14/141 - (9%)

- Green bases have known domain annotations that are detailed below.

  Fly     6 NSEEVSDAGSYKDKGNEAFKASRWEEAVEHYGKAIKAGSKHKELAVFYKNRAAAYLKLGKYENAV 70
            :.|:.::|...|.:|||..|...:|.||..|||||:....:   ||::.||||||.|||.|..||
Human    84 SEEDSAEAERLKTEGNEQMKVENFEAAVHFYGKAIELNPAN---AVYFCNRAAAYSKLGNYAGAV 145

  Fly    71 EDCTESLKAAPGDPKALFRRAQAYEALEKFEEA---YKDATALFKADPGNKTVQPMLQRLHVVVE 132
            :||..::...|...||..|...|..:|.|..||   ||.|..|   ||.|:|.:..|:     :.
Human   146 QDCERAICIDPAYSKAYGRMGLALSSLNKHVEAVAYYKKALEL---DPDNETYKSNLK-----IA 202

  Fly   133 ERSARNAKTST 143
            |...|.|.:.|
Human   203 ELKLREAPSPT 213

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
unc-45	NP_001303425.1	TPR_11	12..81	CDD:290150	30/68 (44%)
		TPR repeat	16..41	CDD:276809	12/24 (50%)
		TPR repeat	46..79	CDD:276809	16/32 (50%)
		TPR_11	50..115	CDD:290150	29/67 (43%)
		TPR	50..83	CDD:197478	17/32 (53%)
		UNC45-central	351..494	CDD:288539
		ARM	668..788	CDD:237987
		armadillo repeat	753..789	CDD:293788
		armadillo repeat	795..826	CDD:293788
SGTA	NP_003012.1	SGTA_dimer	5..64	CDD:406850
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	66..100		4/15 (27%)
		TPR 1	91..124		14/32 (44%)
		TPR repeat	91..119	CDD:276809	13/27 (48%)
		PLN03088	105..>211	CDD:215568	45/116 (39%)
		TPR repeat	124..154	CDD:276809	16/32 (50%)
		TPR 2	125..158		17/32 (53%)
		TPR 3	159..192		14/35 (40%)
		TPR repeat	159..187	CDD:276809	11/27 (41%)
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	250..269
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	1	0.930	-	-		C165155690
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
User_Submission	0	0.000	Not matched by this tool.
	2	1.840