DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment unc-45 and TTC31

DIOPT Version :9

Sequence 1:NP_001303425.1 Gene:unc-45 / 44910 FlyBaseID:FBgn0010812 Length:947 Species:Drosophila melanogaster
Sequence 2:XP_011531337.1 Gene:TTC31 / 64427 HGNCID:25759 Length:539 Species:Homo sapiens


Alignment Length:107 Identity:31/107 - (28%)
Similarity:53/107 - (49%) Gaps:15/107 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 SEEVSDAG-SYKDKGNEAFKASRWEEAVEHYGKAIKAGSKHKELAVFYKNRAAAYLKLGKYENAV 70
            |:|::..| |:...|       .:.|||..:.:|:|...:...|   :.||:..:.:||:...|:
Human   325 SQELAKLGTSFAQNG-------FYHEAVVLFTQALKLNPQDHRL---FGNRSFCHERLGQPAWAL 379

  Fly    71 EDCTESLKAAPGDPKALFRRAQAYEALEKFEEAYKDATALFK 112
            .|...:|...||.|:.|||..:|...|::|.|    |.|:|:
Human   380 ADAQVALTLRPGWPRGLFRLGKALMGLQRFRE----AAAVFQ 417

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
unc-45NP_001303425.1 TPR_11 12..81 CDD:290150 16/69 (23%)
TPR repeat 16..41 CDD:276809 5/24 (21%)
TPR repeat 46..79 CDD:276809 8/32 (25%)
TPR_11 50..115 CDD:290150 20/63 (32%)
TPR 50..83 CDD:197478 8/32 (25%)
UNC45-central 351..494 CDD:288539
ARM 668..788 CDD:237987
armadillo repeat 753..789 CDD:293788
armadillo repeat 795..826 CDD:293788
TTC31XP_011531337.1 TPR_11 324..390 CDD:290150 18/74 (24%)
TPR repeat 325..353 CDD:276809 9/34 (26%)
TPR repeat 358..388 CDD:276809 8/32 (25%)
TPR repeat 393..421 CDD:276809 11/29 (38%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165155689
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.