DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment unc-45 and si:dkey-33c12.4

DIOPT Version :9

Sequence 1:NP_001303425.1 Gene:unc-45 / 44910 FlyBaseID:FBgn0010812 Length:947 Species:Drosophila melanogaster
Sequence 2:XP_021336269.1 Gene:si:dkey-33c12.4 / 560112 ZFINID:ZDB-GENE-030131-2527 Length:648 Species:Danio rerio


Alignment Length:185 Identity:42/185 - (22%)
Similarity:78/185 - (42%) Gaps:33/185 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 INSEEVSDAGSYKDK-------GNEAFKASRWEEAVEHYGKAIKAGSKHKELAVFYKNRAAAYLK 62
            :|.||..:|..:..:       |||...:...|.||:::..|||...|..:|   :.||:..|.|
Zfish   300 VNGEESVNANDFITRSVELAVIGNEYAGSGNMEMAVKYFTDAIKHNPKEYKL---FGNRSYCYEK 361

  Fly    63 LGKYENAVEDCTESLKAAPGDPKALFRRAQAYEALEKFEEAYKDATALFKADPGNKTVQPMLQRL 127
            :.:||.::.|...:|...|...|.|:|:.:|...|:::.||......:.|.|...|.....:.|:
Zfish   362 MLQYEKSLTDAEIALSMNPKWIKGLYRKGRALVGLKRYNEARLTFGEVLKLDSSCKDAAEEIMRV 426

  Fly   128 HVVVEERSARNAKTSTKVKQMMDLTFDLATPIDKRRAAANNLVVLAKEQTGAELL 182
            .::                |:|::.|       .:..::|.|::....:...|.|
Zfish   427 QLM----------------QLMEMGF-------TKEQSSNALIIHGTVERALESL 458

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
unc-45NP_001303425.1 TPR_11 12..81 CDD:290150 20/75 (27%)
TPR repeat 16..41 CDD:276809 7/31 (23%)
TPR repeat 46..79 CDD:276809 9/32 (28%)
TPR_11 50..115 CDD:290150 17/64 (27%)
TPR 50..83 CDD:197478 9/32 (28%)
UNC45-central 351..494 CDD:288539
ARM 668..788 CDD:237987
armadillo repeat 753..789 CDD:293788
armadillo repeat 795..826 CDD:293788
si:dkey-33c12.4XP_021336269.1 PLN03088 258..>439 CDD:330826 38/164 (23%)
TPR repeat 348..378 CDD:276809 9/32 (28%)
TPR repeat 383..411 CDD:276809 7/27 (26%)
UBA 430..456 CDD:270456 5/32 (16%)
RRM <471..>614 CDD:223796
RRM 519..584 CDD:214636
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170590868
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.