DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment unc-45 and SGTB

DIOPT Version :10

Sequence 1:NP_524796.1 Gene:unc-45 / 44910 FlyBaseID:FBgn0288846 Length:947 Species:Drosophila melanogaster
Sequence 2:NP_061945.1 Gene:SGTB / 54557 HGNCID:23567 Length:304 Species:Homo sapiens


Alignment Length:160 Identity:52/160 - (32%)
Similarity:80/160 - (50%) Gaps:13/160 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MTNTINSEEVSDAGSYKDKGNEAFKASRWEEAVEHYGKAIKAGSKHKELAVFYKNRAAAYLKLGK 65
            ::|:: .|:|..|...||:||...|...:..||:.|.:||:....:   ||:|.|||||..|||.
Human    74 LSNSV-PEDVGKADQLKDEGNNHMKEENYAAAVDCYTQAIELDPNN---AVYYCNRAAAQSKLGH 134

  Fly    66 YENAVEDCTESLKAAPGDPKALFRRAQAYEALEKFEEAYKDATALFKADPGNKTVQPMLQRLHVV 130
            |.:|::||.:::.......||..|...|..||.|||||..........||.|.:.:..|:     
Human   135 YTDAIKDCEKAIAIDSKYSKAYGRMGLALTALNKFEEAVTSYQKALDLDPENDSYKSNLK----- 194

  Fly   131 VEERSARNAKTSTKVKQMMDLTFDLATPID 160
            :.|:..|...:.|..    .|:||:|:.|:
Human   195 IAEQKLREVSSPTGT----GLSFDMASLIN 220

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
unc-45NP_524796.1 3a0801s09 7..>127 CDD:273380 43/119 (36%)
TPR repeat 16..41 CDD:276809 9/24 (38%)
TPR repeat 46..79 CDD:276809 15/32 (47%)
UNC45-central 351..494 CDD:432011
PLN03200 399..>700 CDD:215629
armadillo repeat 753..789 CDD:293788
armadillo repeat 795..826 CDD:293788
SGTBNP_061945.1 SGTA_dimer 5..64 CDD:465168
TPR 1 15..49
TPR 2 85..118 11/32 (34%)
TPR repeat 85..113 CDD:276809 10/27 (37%)
TPR 92..>200 CDD:440225 39/115 (34%)
TPR repeat 118..148 CDD:276809 15/32 (47%)
TPR 3 119..152 15/32 (47%)
TPR 4 153..186 13/32 (41%)
TPR repeat 153..181 CDD:276809 11/27 (41%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.