DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment unc-45 and SGTB

DIOPT Version :9

Sequence 1:NP_001303425.1 Gene:unc-45 / 44910 FlyBaseID:FBgn0010812 Length:947 Species:Drosophila melanogaster
Sequence 2:NP_061945.1 Gene:SGTB / 54557 HGNCID:23567 Length:304 Species:Homo sapiens


Alignment Length:160 Identity:52/160 - (32%)
Similarity:80/160 - (50%) Gaps:13/160 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MTNTINSEEVSDAGSYKDKGNEAFKASRWEEAVEHYGKAIKAGSKHKELAVFYKNRAAAYLKLGK 65
            ::|:: .|:|..|...||:||...|...:..||:.|.:||:....:   ||:|.|||||..|||.
Human    74 LSNSV-PEDVGKADQLKDEGNNHMKEENYAAAVDCYTQAIELDPNN---AVYYCNRAAAQSKLGH 134

  Fly    66 YENAVEDCTESLKAAPGDPKALFRRAQAYEALEKFEEAYKDATALFKADPGNKTVQPMLQRLHVV 130
            |.:|::||.:::.......||..|...|..||.|||||..........||.|.:.:..|:     
Human   135 YTDAIKDCEKAIAIDSKYSKAYGRMGLALTALNKFEEAVTSYQKALDLDPENDSYKSNLK----- 194

  Fly   131 VEERSARNAKTSTKVKQMMDLTFDLATPID 160
            :.|:..|...:.|..    .|:||:|:.|:
Human   195 IAEQKLREVSSPTGT----GLSFDMASLIN 220

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
unc-45NP_001303425.1 TPR_11 12..81 CDD:290150 26/68 (38%)
TPR repeat 16..41 CDD:276809 9/24 (38%)
TPR repeat 46..79 CDD:276809 15/32 (47%)
TPR_11 50..115 CDD:290150 26/64 (41%)
TPR 50..83 CDD:197478 15/32 (47%)
UNC45-central 351..494 CDD:288539
ARM 668..788 CDD:237987
armadillo repeat 753..789 CDD:293788
armadillo repeat 795..826 CDD:293788
SGTBNP_061945.1 SGTA_dimer 5..64 CDD:318697
TPR 1 15..49
PLN03088 85..>237 CDD:330826 49/148 (33%)
TPR 2 85..118 11/32 (34%)
TPR repeat 85..113 CDD:276809 10/27 (37%)
TPR repeat 118..148 CDD:276809 15/32 (47%)
TPR 3 119..152 15/32 (47%)
TPR 4 153..186 13/32 (41%)
TPR repeat 153..181 CDD:276809 11/27 (41%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165155699
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.