Sequence 1: | NP_001303425.1 | Gene: | unc-45 / 44910 | FlyBaseID: | FBgn0010812 | Length: | 947 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001345478.1 | Gene: | Sgta / 52551 | MGIID: | 1098703 | Length: | 315 | Species: | Mus musculus |
Alignment Length: | 206 | Identity: | 64/206 - (31%) |
---|---|---|---|
Similarity: | 88/206 - (42%) | Gaps: | 41/206 - (19%) |
- Green bases have known domain annotations that are detailed below.
Fly 6 NSEEVSDAGSYKDKGNEAFKASRWEEAVEHYGKAIKAGSKHKELAVFYKNRAAAYLKLGKYENAV 70
Fly 71 EDCTESLKAAPGDPKALFRRAQAYEALEKFEEA---YKDATALFKADPGNKTVQPMLQRLHVVVE 132
Fly 133 ERSARNAKTSTKVKQMMDLTFDLATPIDKRRAAANNLVVLAKEQTGAELLYKDHCIAKVASLTKV 197
Fly 198 EKDQDIYVNMV 208 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
unc-45 | NP_001303425.1 | TPR_11 | 12..81 | CDD:290150 | 30/68 (44%) |
TPR repeat | 16..41 | CDD:276809 | 12/24 (50%) | ||
TPR repeat | 46..79 | CDD:276809 | 16/32 (50%) | ||
TPR_11 | 50..115 | CDD:290150 | 30/67 (45%) | ||
TPR | 50..83 | CDD:197478 | 17/32 (53%) | ||
UNC45-central | 351..494 | CDD:288539 | |||
ARM | 668..788 | CDD:237987 | |||
armadillo repeat | 753..789 | CDD:293788 | |||
armadillo repeat | 795..826 | CDD:293788 | |||
Sgta | NP_001345478.1 | SGTA_dimer | 5..64 | CDD:318697 | |
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 65..100 | 3/14 (21%) | |||
TPR 1 | 92..125 | 14/32 (44%) | |||
TPR repeat | 92..120 | CDD:276809 | 13/27 (48%) | ||
PLN03088 | 106..>212 | CDD:330826 | 46/116 (40%) | ||
TPR repeat | 125..155 | CDD:276809 | 16/32 (50%) | ||
TPR 2 | 126..159 | 17/32 (53%) | |||
TPR 3 | 160..193 | 14/35 (40%) | |||
TPR repeat | 160..188 | CDD:276809 | 11/27 (41%) | ||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 249..270 | 1/4 (25%) | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C167846130 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 1 | 1.000 | - | - | ||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
3 | 2.840 |