DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment unc-45 and sgtb

DIOPT Version :9

Sequence 1:NP_001303425.1 Gene:unc-45 / 44910 FlyBaseID:FBgn0010812 Length:947 Species:Drosophila melanogaster
Sequence 2:NP_001002225.2 Gene:sgtb / 431772 ZFINID:ZDB-GENE-040704-72 Length:320 Species:Danio rerio


Alignment Length:153 Identity:47/153 - (30%)
Similarity:75/153 - (49%) Gaps:12/153 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 EEVSDAGSYKDKGNEAFKASRWEEAVEHYGKAIKAGSKHKELAVFYKNRAAAYLKLGKYENAVED 72
            |::..|...|::||...|...:..||:.|.|||:...::   ||:|.|||||:.||..|..|:.|
Zfish    96 EDIERAEQLKNEGNNHMKEENYSSAVDCYTKAIELDQRN---AVYYCNRAAAHSKLENYTEAMGD 157

  Fly    73 CTESLKAAPGDPKALFRRAQAYEALEKFEEAYKDATALFKADPGNKTVQPMLQRLHVVVEERSAR 137
            |..::...|...||..|...|..::.|:.||..........||.|.|.:   ..|.:|.:::...
Zfish   158 CERAIAIDPSYSKAYGRMGLALTSMSKYPEAISYFNKALVLDPENDTYK---SNLKIVEQKQKEA 219

  Fly   138 NAKTSTKVKQMMDLTFDLATPID 160
            ::.|:|      .|.||:|:.|:
Zfish   220 SSPTAT------GLGFDMASLIN 236

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
unc-45NP_001303425.1 TPR_11 12..81 CDD:290150 25/68 (37%)
TPR repeat 16..41 CDD:276809 9/24 (38%)
TPR repeat 46..79 CDD:276809 14/32 (44%)
TPR_11 50..115 CDD:290150 22/64 (34%)
TPR 50..83 CDD:197478 15/32 (47%)
UNC45-central 351..494 CDD:288539
ARM 668..788 CDD:237987
armadillo repeat 753..789 CDD:293788
armadillo repeat 795..826 CDD:293788
sgtbNP_001002225.2 TPR_11 134..200 CDD:290150 22/68 (32%)
TPR repeat 134..164 CDD:276809 14/32 (44%)
TPR_1 135..168 CDD:278916 15/32 (47%)
TPR_1 169..202 CDD:278916 9/32 (28%)
TPR repeat 169..196 CDD:276809 7/26 (27%)
SGTA_dimer 20..76 CDD:293154
TPR_11 100..166 CDD:290150 25/68 (37%)
TPR 101..134 CDD:197478 11/32 (34%)
TPR repeat 101..129 CDD:276809 10/27 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170590872
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.