DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment unc-45 and HIP-R

DIOPT Version :9

Sequence 1:NP_001303425.1 Gene:unc-45 / 44910 FlyBaseID:FBgn0010812 Length:947 Species:Drosophila melanogaster
Sequence 2:NP_001014719.2 Gene:HIP-R / 31335 FlyBaseID:FBgn0029676 Length:377 Species:Drosophila melanogaster


Alignment Length:178 Identity:50/178 - (28%)
Similarity:77/178 - (43%) Gaps:34/178 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 EEVSDAGSYKDKGNEAFKASRWEEAVEHYGKAIKAGSKHKELAVFYKNRAAAYLKLGKYENAVED 72
            |||..|...:.:...|:...:::||:..|.|||:....:   |:|:..|..|:|||.|....:.|
  Fly   121 EEVEQASELRAQAASAYGQQKFDEAIALYTKAIELSPGN---ALFHAKRGQAFLKLKKPNACIRD 182

  Fly    73 CTESLKAAPGDPKALFR-RAQAYEALEKFEEAYKDATALFKADPGNKT------VQPMLQRL--H 128
            |..:|: ...|..|.:: |.:|...|..||.|..|.....|.|...:|      |.|..:::  |
  Fly   183 CDVALE-LNSDLAAGYKFRGRARRLLGDFELAAHDLRQACKLDFDEETDEWLKEVTPNAKKIEQH 246

  Fly   129 VVVEERSARNAKTSTKVKQMMDLTFDLATPIDKRRAAANNLVVLAKEQ 176
            .:.:||  |.|:...|.:|.           |:|||        .|||
  Fly   247 RLKQER--RQAERKIKERQR-----------DQRRA--------RKEQ 273

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
unc-45NP_001303425.1 TPR_11 12..81 CDD:290150 19/68 (28%)
TPR repeat 16..41 CDD:276809 6/24 (25%)
TPR repeat 46..79 CDD:276809 11/32 (34%)
TPR_11 50..115 CDD:290150 21/65 (32%)
TPR 50..83 CDD:197478 11/32 (34%)
UNC45-central 351..494 CDD:288539
ARM 668..788 CDD:237987
armadillo repeat 753..789 CDD:293788
armadillo repeat 795..826 CDD:293788
HIP-RNP_001014719.2 Hip_N 10..47 CDD:271228
TPR_11 125..190 CDD:290150 19/68 (28%)
TPR_2 126..159 CDD:285020 8/32 (25%)
TPR repeat 126..154 CDD:276809 7/27 (26%)
TPR repeat 159..189 CDD:276809 11/33 (33%)
TPR repeat 194..222 CDD:276809 8/27 (30%)
STI1 299..336 CDD:128966
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45462453
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.