DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment unc-45 and Tomm34

DIOPT Version :9

Sequence 1:	NP_001303425.1	Gene:	unc-45 / 44910	FlyBaseID:	FBgn0010812	Length:	947	Species:	Drosophila melanogaster
Sequence 2:	NP_001037709.1	Gene:	Tomm34 / 311621	RGDID:	1309029	Length:	309	Species:	Rattus norvegicus

Alignment Length:	131	Identity:	42/131 - (32%)
Similarity:	70/131 - (53%)	Gaps:	9/131 - (6%)

- Green bases have known domain annotations that are detailed below.

  Fly     4 TINSEEVSDAGS------YKDKGNEAFKASRWEEAVEHYGKAIKAGSKHKELAVFYKNRAAAYLK 62
            |.....|..||.      .|::|||..|....::|:|.|.:::...|..   :..|.|||..:|.
  Rat   178 TATKNRVPSAGDVERARVLKEEGNELVKKGNHKKAIEKYSESLLFSSLE---SATYSNRALCHLV 239

  Fly    63 LGKYENAVEDCTESLKAAPGDPKALFRRAQAYEALEKFEEAYKDATALFKADPGNKTVQPMLQRL 127
            |.:|:.|.:||||:||....:.||.:||||||:||:.::.:..|.::|.:.:|.|.....:.|.:
  Rat   240 LKQYKEAEKDCTEALKLDGKNVKAFYRRAQAYKALKDYKSSLADISSLLQIEPRNGPAHKLRQEV 304

  Fly   128 H 128
            :
  Rat   305 N 305

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
unc-45	NP_001303425.1	TPR_11	12..81	CDD:290150	25/74 (34%)
		TPR repeat	16..41	CDD:276809	8/24 (33%)
		TPR repeat	46..79	CDD:276809	13/32 (41%)
		TPR_11	50..115	CDD:290150	26/64 (41%)
		TPR	50..83	CDD:197478	14/32 (44%)
		UNC45-central	351..494	CDD:288539
		ARM	668..788	CDD:237987
		armadillo repeat	753..789	CDD:293788
		armadillo repeat	795..826	CDD:293788
Tomm34	NP_001037709.1	TPR repeat	261..289	CDD:276809	12/27 (44%)
		TPR 6	262..294		13/31 (42%)
		TPR 1	9..42
		TPR repeat	9..37	CDD:276809
		3a0801s09	<11..>294	CDD:273380	40/118 (34%)
		TPR repeat	50..80	CDD:276809
		TPR 2	51..84
		TPR repeat	85..113	CDD:276809
		TPR 3	86..118
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	158..187		2/8 (25%)
		TPR 4	193..226		9/32 (28%)
		TPR repeat	193..221	CDD:276809	8/27 (30%)
		TPR repeat	226..256	CDD:276809	13/32 (41%)
		TPR 5	227..260		14/32 (44%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	1	0.930	-	-		C166349600
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	1	1.000	-	-
TreeFam	0	0.000	Not matched by this tool.
	3	2.840