Sequence 1: | NP_001303425.1 | Gene: | unc-45 / 44910 | FlyBaseID: | FBgn0010812 | Length: | 947 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001013069.1 | Gene: | Sugt1 / 290408 | RGDID: | 1307550 | Length: | 336 | Species: | Rattus norvegicus |
Alignment Length: | 218 | Identity: | 46/218 - (21%) |
---|---|---|---|
Similarity: | 88/218 - (40%) | Gaps: | 34/218 - (15%) |
- Green bases have known domain annotations that are detailed below.
Fly 30 EEAVEHYGKAIKAGSKHKELAVFYKNRAAAYLKLGKYENAVEDCTESLKAAPGDPKALFRR--AQ 92
Fly 93 AYE-----ALEKFEEAYK-DATALFKADPGNKTVQPMLQRLHVVVEERSARNAKTSTKVKQMMDL 151
Fly 152 TFDLATPIDKRRAAANNLVVLAKEQTGAELLYKDHCIAKVASLTKVEKDQDIYVNMVHLVAALCE 216
Fly 217 NSVERTKGVLTEL------GVPW 233 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
unc-45 | NP_001303425.1 | TPR_11 | 12..81 | CDD:290150 | 15/50 (30%) |
TPR repeat | 16..41 | CDD:276809 | 4/10 (40%) | ||
TPR repeat | 46..79 | CDD:276809 | 11/32 (34%) | ||
TPR_11 | 50..115 | CDD:290150 | 25/72 (35%) | ||
TPR | 50..83 | CDD:197478 | 12/32 (38%) | ||
UNC45-central | 351..494 | CDD:288539 | |||
ARM | 668..788 | CDD:237987 | |||
armadillo repeat | 753..789 | CDD:293788 | |||
armadillo repeat | 795..826 | CDD:293788 | |||
Sugt1 | NP_001013069.1 | TPR 1 | 11..44 | 4/18 (22%) | |
PLN03088 | 21..336 | CDD:215568 | 46/218 (21%) | ||
TPR repeat | 44..74 | CDD:276809 | 11/29 (38%) | ||
TPR 2 | 45..78 | 12/32 (38%) | |||
TPR | 45..78 | CDD:197478 | 12/32 (38%) | ||
TPR 3 | 79..112 | 13/37 (35%) | |||
TPR repeat | 79..107 | CDD:276809 | 10/27 (37%) | ||
p23_CS_hSgt1_like | 146..229 | CDD:107239 | 11/80 (14%) | ||
SGS | 256..336 | CDD:282811 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C166349602 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.930 |