DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment unc-45 and TTC32

DIOPT Version :9

Sequence 1:NP_001303425.1 Gene:unc-45 / 44910 FlyBaseID:FBgn0010812 Length:947 Species:Drosophila melanogaster
Sequence 2:NP_001008238.1 Gene:TTC32 / 130502 HGNCID:32954 Length:151 Species:Homo sapiens


Alignment Length:129 Identity:32/129 - (24%)
Similarity:54/129 - (41%) Gaps:15/129 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 FKASRWEEAVEHYGKAIK-----------AGSK--HKELAVFYKNRA-AAYLKLGKYENAVEDCT 74
            |....:.||...|...|:           .|||  .::||..|.||. ..|.::..|| |::|.|
Human    19 FNNGEYAEAEALYSAYIRRCACAASSDESPGSKCSPEDLATAYNNRGQIKYFRVDFYE-AMDDYT 82

  Fly    75 ESLKAAPGDPKALFRRAQAYEALEKFEEAYKDATALFKADPGNKTVQPMLQRLHVVVEERSARN 138
            .:::..|......:.|......|..|::|.:|...:...:||.:.....|::..:..||:..||
Human    83 SAIEVQPNFEVPYYNRGLILYRLGYFDDALEDFKKVLDLNPGFQDATLSLKQTILDKEEKQRRN 146

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
unc-45NP_001303425.1 TPR_11 12..81 CDD:290150 19/70 (27%)
TPR repeat 16..41 CDD:276809 4/16 (25%)
TPR repeat 46..79 CDD:276809 11/33 (33%)
TPR_11 50..115 CDD:290150 16/65 (25%)
TPR 50..83 CDD:197478 11/33 (33%)
UNC45-central 351..494 CDD:288539
ARM 668..788 CDD:237987
armadillo repeat 753..789 CDD:293788
armadillo repeat 795..826 CDD:293788
TTC32NP_001008238.1 TPR_11 2..>143 CDD:330823 30/124 (24%)
TPR 1 8..41 5/21 (24%)
PLN03088 <55..>123 CDD:330826 17/68 (25%)
TPR repeat 57..87 CDD:276809 11/30 (37%)
TPR 2 58..91 11/33 (33%)
TPR 3 92..125 6/32 (19%)
TPR repeat 92..120 CDD:276809 5/27 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165155701
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.