DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment unc-45 and SUGT1

DIOPT Version :10

Sequence 1:NP_524796.1 Gene:unc-45 / 44910 FlyBaseID:FBgn0288846 Length:947 Species:Drosophila melanogaster
Sequence 2:NP_001124384.1 Gene:SUGT1 / 10910 HGNCID:16987 Length:365 Species:Homo sapiens


Alignment Length:83 Identity:26/83 - (31%)
Similarity:42/83 - (50%) Gaps:10/83 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 EEAVEHYGKAIKAGSKHKELAVFYKNRAAAYLKLGKYENAVEDCTESLKAAPGDPKALFRR--AQ 92
            :.|:|...||::   :..:.|.:|..||..::.||.|..||.|..:||:..|.:..|:.|:  .:
Human    28 QAALEELTKALE---QKPDDAQYYCQRAYCHILLGNYCVAVADAKKSLELNPNNSTAMLRKGICE 89

  Fly    93 AYE-----ALEKFEEAYK 105
            .:|     |||.|.|..|
Human    90 YHEKNYAAALETFTEGQK 107

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
unc-45NP_524796.1 3a0801s09 7..>127 CDD:273380 26/83 (31%)
TPR repeat 16..41 CDD:276809 4/10 (40%)
TPR repeat 46..79 CDD:276809 12/32 (38%)
UNC45-central 351..494 CDD:432011
PLN03200 399..>700 CDD:215629
armadillo repeat 753..789 CDD:293788
armadillo repeat 795..826 CDD:293788
SUGT1NP_001124384.1 TPR 1 11..44 4/18 (22%)
PLN03088 21..365 CDD:215568 26/83 (31%)
TPR repeat 44..74 CDD:276809 12/29 (41%)
TPR 2 45..78 13/32 (41%)
TPR 3 79..112 9/29 (31%)
TPR repeat 79..107 CDD:276809 8/27 (30%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.