DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment unc-45 and ttc32

DIOPT Version :9

Sequence 1:	NP_001303425.1	Gene:	unc-45 / 44910	FlyBaseID:	FBgn0010812	Length:	947	Species:	Drosophila melanogaster
Sequence 2:	NP_001020691.1	Gene:	ttc32 / 100004012	ZFINID:	ZDB-GENE-041014-158	Length:	136	Species:	Danio rerio

Alignment Length:	125	Identity:	33/125 - (26%)
Similarity:	59/125 - (47%)	Gaps:	7/125 - (5%)

- Green bases have known domain annotations that are detailed below.

  Fly    19 KGNEAFKASRWEEAVEHYGKAIKAGSKHK-----ELAVFYKNRA-AAYLKLGKYENAVEDCTESL 77
            |.:|.|.:..::.|.|.|.:.|::.:|.:     :||:.|.||. ..||::..|| |::|.|.::
Zfish    11 KAHEEFNSKNYKRAEELYTQFIESCTKSRDCNGQDLAIAYNNRGQVKYLRVDFYE-AMDDYTSAI 74

  Fly    78 KAAPGDPKALFRRAQAYEALEKFEEAYKDATALFKADPGNKTVQPMLQRLHVVVEERSAR 137
            .........|:.|......|..|:||..|...:.:.:|..|..:..|.:..:..||:..|
Zfish    75 HINRQFEVPLYNRGLIRYRLGFFKEAEGDFRRVLELNPDFKDAKESLNQTLLDREEKVKR 134

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
unc-45	NP_001303425.1	TPR_11	12..81	CDD:290150	20/67 (30%)
		TPR repeat	16..41	CDD:276809	6/21 (29%)
		TPR repeat	46..79	CDD:276809	12/38 (32%)
		TPR_11	50..115	CDD:290150	18/65 (28%)
		TPR	50..83	CDD:197478	11/33 (33%)
		UNC45-central	351..494	CDD:288539
		ARM	668..788	CDD:237987
		armadillo repeat	753..789	CDD:293788
		armadillo repeat	795..826	CDD:293788
ttc32	NP_001020691.1	TPR_11	9..77	CDD:290150	20/66 (30%)
		TPR repeat	9..33	CDD:276809	6/21 (29%)
		TPR repeat	46..76	CDD:276809	12/30 (40%)
		TPR_11	47..112	CDD:290150	18/65 (28%)
		TPR repeat	81..109	CDD:276809	7/27 (26%)
		TPR_1	84..114	CDD:278916	8/29 (28%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	1	0.930	-	-		C170590874
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
ZFIN	0	0.000	Not matched by this tool.
	1	0.930