DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Larp7 and SSB

DIOPT Version :9

Sequence 1:NP_524795.2 Gene:Larp7 / 44900 FlyBaseID:FBgn0260771 Length:595 Species:Drosophila melanogaster
Sequence 2:NP_001281074.1 Gene:SSB / 6741 HGNCID:11316 Length:408 Species:Homo sapiens


Alignment Length:444 Identity:113/444 - (25%)
Similarity:186/444 - (41%) Gaps:110/444 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    49 KDGGRKRKRHLFNSIRGQMEFYFGDANLSKDRFLRRYVEQDP-YVPLEIFLTFNKIKTLTQDVQQ 112
            ::|..::...|...|..|:|:||||.||.:|:||:..::.|. :|||||.:.||::..||.|...
Human     3 ENGDNEKMAALEAKICHQIEYYFGDFNLPRDKFLKEQIKLDEGWVPLEIMIKFNRLNRLTTDFNV 67

  Fly   113 IAKALSNS--QLLELDETELKVKRRTK--LPD-----QRDVNDKTLYVEALPANATHDWLKEVFS 168
            |.:|||.|  :|:|:.|.:.|::|...  ||:     :.||.::::|::..|.:||.|.:||...
Human    68 IVEALSKSKAELMEISEDKTKIRRSPSKPLPEVTDEYKNDVKNRSVYIKGFPTDATLDDIKEWLE 132

  Fly   169 RYGPVAYVSLP---HYPGTKKIKEFAFIEFEKSGSLEKAVKAFAQIQGVLSVETDPSDL------ 224
            ..|.|..:.:.   |    |..|...|:.|:   |:|.| |.|.:..|....|||...|      
Human   133 DKGQVLNIQMRRTLH----KAFKGSIFVVFD---SIESA-KKFVETPGQKYKETDLLILFKDDYF 189

  Fly   225 -------------ASVRSFQQQQQIQQKAEQPQSEAEQVELPKR--NLKREATDKD----REEIH 270
                         |.:|: :|:|:.:||.|:   :||...|.::  .|.:.:.|.|    ||::|
Human   190 AKKNEERKQNKVEAKLRA-KQEQEAKQKLEE---DAEMKSLEEKIGCLLKFSGDLDDQTCREDLH 250

  Fly   271 -------EVKRVKLEEGQPSETSTAGETASET-----DA-EGTAEASEQEDKTEATDGD---EAA 319
                   |:|.:....|.........|.|.|.     || .|..:...:|...|..:|:   ||.
Human   251 ILFSNHGEIKWIDFVRGAKEGIILFKEKAKEALGKAKDANNGNLQLRNKEVTWEVLEGEVEKEAL 315

  Fly   320 KK----------------RRRKRKKKAIVDKPNIEPSALELKVLPKTSWSSMRNKYLNLQRRIVS 368
            ||                ||.|.|.|.   ....:|.:.:.||    .:...:.|:.:       
Human   316 KKIIEDQQESLNKWKSKGRRFKGKGKG---NKAAQPGSGKGKV----QFQGKKTKFAS------- 366

  Fly   369 EAKSKLWRENHPQNQQHPHHQQTSHPNHPKPSQLPEAVKEEETGGEVPSDGGEG 422
                         :.:|..|.:.......|.:: .|..|||....:..::.|.|
Human   367 -------------DDEHDEHDENGATGPVKRAR-EETDKEEPASKQQKTENGAG 406

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Larp7NP_524795.2 LA 57..135 CDD:128955 33/80 (41%)
RRM <116..>208 CDD:223796 31/103 (30%)
RRM1_LARP7 148..>209 CDD:240736 18/63 (29%)
RRM2_LARP7 471..548 CDD:240986
SSBNP_001281074.1 LARP_3 10..91 CDD:153397 33/80 (41%)
RRM1_La 112..183 CDD:240737 23/78 (29%)
RRM_3 231..334 CDD:370115 22/102 (22%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 329..408 18/106 (17%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R649
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.940

Return to query results.
Submit another query.