DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Larp7 and larp

DIOPT Version :9

Sequence 1:NP_524795.2 Gene:Larp7 / 44900 FlyBaseID:FBgn0260771 Length:595 Species:Drosophila melanogaster
Sequence 2:NP_001247347.1 Gene:larp / 53567 FlyBaseID:FBgn0261618 Length:1673 Species:Drosophila melanogaster


Alignment Length:430 Identity:84/430 - (19%)
Similarity:147/430 - (34%) Gaps:112/430 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    62 SIRGQMEFYFGDANLSKDRFLRRYVEQDPYVPLEIFLTFNKIKTLTQDVQQIAKALSNSQLLELD 126
            :|:.|:|:||...||:.|.||||.::.:.|:|:.:..:|:::..||.||..|..|:..|..|||.
  Fly   732 AIKKQVEYYFSVDNLTGDFFLRRKMDPEGYIPVTLIASFHRVLALTTDVAVIVNAIKESDKLELF 796

  Fly   127 ETELKVKRR--------TKLPDQRDVNDKTLYVEALPANATHDWLKEVFSRYGPVAYVSLPHYPG 183
            | ..||:.:        |::|:..:...|.:                     |.:....|....|
  Fly   797 E-GYKVRTKTTPTTWPITEVPEVNEGEPKAI---------------------GTLEQEQLEQNDG 839

  Fly   184 TKKIKEFAFIEFEKSGSLEKAVKAFAQIQGVLSVETD--PSDLASVRSFQQQQQIQQKAEQPQSE 246
            .:|::|                          ..|.|  |..|.|..:.:....|   ...|...
  Fly   840 QEKLEE--------------------------QTEADSPPPILTSAMATKPLNSI---PPPPMPR 875

  Fly   247 AEQVELPK----RNLKREATDKDREEIHEVKRVKLE-EGQPSETSTAGETASETDAEGTAEASEQ 306
            ..|..:||    :...|.:|......::.:..:..: ||..:|  .||..:...::......|..
  Fly   876 NPQNLVPKMLQDKQQSRSSTIAALNSVNAISALTQQVEGGAAE--LAGHLSGLAESVKPKSTSTP 938

  Fly   307 EDKTEATDGDEAAKKRRRKRKKKAIVDKPNIEPSALELKVLPKTSWSSMRNKYLNLQRRIVSEAK 371
            :.:..|:.|:.|.                    ||..|...|:..|..::.:           :|
  Fly   939 DKRNAASAGNGAG--------------------SAAALVAEPEGIWKEVKRR-----------SK 972

  Fly   372 SKLWREN--HPQNQQHPHHQQTSHPNHPKPSQLPEAVKEEETGGEVPSDGGEGAVEAAPV--PAK 432
            :...:||  .|..||.|...||.:.|:........:.|.:.:....||:....|......  .:.
  Fly   973 TNAIKENATTPPQQQQPPLSQTLNNNNDNVKTNNTSSKSKSSSNNAPSNASSSATVCVTTNNASS 1037

  Fly   433 RRKAVHKMNM---------NFYGAGGVESTKSEEPSQERT 463
            ..||..|...         |...:|....:|:...|..:|
  Fly  1038 ATKATTKTTTTSTATTTTNNNIKSGNAAYSKTHSKSSSKT 1077

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Larp7NP_524795.2 LA 57..135 CDD:128955 28/72 (39%)
RRM <116..>208 CDD:223796 16/99 (16%)
RRM1_LARP7 148..>209 CDD:240736 5/60 (8%)
RRM2_LARP7 471..548 CDD:240986
larpNP_001247347.1 LARP_1_2 730..803 CDD:153403 28/71 (39%)
DM15 1341..1382 CDD:128927
DM15 1383..1421 CDD:128927
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45456175
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR22792
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.