DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Larp7 and sla1

DIOPT Version :9

Sequence 1:NP_524795.2 Gene:Larp7 / 44900 FlyBaseID:FBgn0260771 Length:595 Species:Drosophila melanogaster
Sequence 2:NP_593315.1 Gene:sla1 / 2541530 PomBaseID:SPAC57A10.10c Length:298 Species:Schizosaccharomyces pombe


Alignment Length:324 Identity:82/324 - (25%)
Similarity:145/324 - (44%) Gaps:50/324 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 SIEKEKGE------GQEPATSAEKPDPAAP-TEPAEENSKEPAPEDASPDKKDGGRKRKRHLFNS 62
            |.|::|.|      .||.::...|.:.|.. .|..::.:.|...|:.:..|:|.|:|........
pombe     2 STEEQKEEIKDISSKQENSSEVPKAEEAGKVVESQKDTTSEEKKEETTEKKEDDGKKDLSFDEAE 66

  Fly    63 IRGQMEFYFGDANLSKDRFL-RRYVEQDPYVPLEIFLTFNKIKTLTQDVQQIAKALSNS-QLLEL 125
            :..|:||||.|.||..|:|| ....:.|.:||::....|.:::.. |.::.|..||..| :|||:
pombe    67 VLKQVEFYFSDTNLPHDKFLWTTSQKNDGWVPIQTIANFKRMRRF-QPLEAIVNALRKSPELLEV 130

  Fly   126 DETELKVKRRTKL--PDQRDVNDKTLYVEAL--PANATHDWLKEVF-SRYGPVAYVSLPHYPGTK 185
            ||...||:|...|  .|.:.|.::::|.:..  ..:.|...|::.| ...||::.|.: .....|
pombe   131 DEAGEKVRRMIPLVRVDNKSVMERSVYCKGFGDEKDDTQIALEKFFEENAGPISAVRM-RRDDDK 194

  Fly   186 KIKEFAFIEFEKSGSLEKAVKAFAQIQGVLSVETDP----SDLASVRSFQQQQQIQQKAEQPQSE 246
            |.|...|:||::.....|.::         .|:|.|    .|..::.|  :::.:..|||..:::
pombe   195 KFKGSVFVEFKEPDVANKFLE---------KVKTAPLKWGEDELTIMS--KKEYVDMKAELHKND 248

  Fly   247 AEQVELPKRNLKREATDKDREEIHEVKRVKLEEGQPSETSTAG-----ETASETDAEGTAEASE 305
            .     ||.:.||...|..:|         ::..:|.:.|..|     :.:|....|..:.|||
pombe   249 P-----PKFSSKRRRFDAFKE---------MDRQRPGKYSNRGRKFKKQRSSNASEEKPSAASE 298

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Larp7NP_524795.2 LA 57..135 CDD:128955 27/79 (34%)
RRM <116..>208 CDD:223796 28/97 (29%)
RRM1_LARP7 148..>209 CDD:240736 14/63 (22%)
RRM2_LARP7 471..548 CDD:240986
sla1NP_593315.1 LHP1 1..298 CDD:227520 80/322 (25%)
LA_like_fungal 64..139 CDD:153398 27/75 (36%)
RRM1_La 155..232 CDD:240737 18/86 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 51 1.000 Domainoid score I3340
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R649
SonicParanoid 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
32.990

Return to query results.
Submit another query.