DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ph-d and L3MBTL3

DIOPT Version :9

Sequence 1:NP_524794.2 Gene:ph-d / 44889 FlyBaseID:FBgn0004860 Length:1537 Species:Drosophila melanogaster
Sequence 2:XP_006715639.1 Gene:L3MBTL3 / 84456 HGNCID:23035 Length:815 Species:Homo sapiens


Alignment Length:158 Identity:49/158 - (31%)
Similarity:72/158 - (45%) Gaps:22/158 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly  1372 DEAMAEEKMQTESYQTVSDALPIQAATPEVPPISMPVLAAMSTSSPL-SLPLTLPLPIAIAPTVS 1435
            |:...:.:.:|||....|.........|.|..........:|..||: .|||.......:.|||:
Human   669 DDVKEDFEERTESEMRTSHEARGAREEPTVQQAQRRSAVFLSFKSPIPCLPLRWEQQSKLLPTVA 733

  Fly  1436 LPVVSAGVVAPVLAIPSSNINGSDRPPISSWSVEEVSNFIRELPGCQDYVDDFIQQEIDGQALLL 1500
                         .||:|.        :|.||.:|||.||:.||||:::...|..::|||:|.||
Human   734 -------------GIPASK--------VSKWSTDEVSEFIQSLPGCEEHGKVFKDEQIDGEAFLL 777

  Fly  1501 LKENHLVNAMGMKLGPALKIVAKVESIK 1528
            :.:..:|..|.:||||||||...:...|
Human   778 MTQTDIVKIMSIKLGPALKIFNSILMFK 805

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ph-dNP_524794.2 SAM_Ph1,2,3 1461..1529 CDD:188976 30/68 (44%)
SAM 1464..1529 CDD:197735 30/65 (46%)
L3MBTL3XP_006715639.1 MBT 271..367 CDD:214723
MBT 380..474 CDD:214723
MBT 486..578 CDD:214723
zf-C2HC 592..619 CDD:279824
SAM 740..806 CDD:197735 30/66 (45%)
SAM_Scm-like-3MBT3,4 740..805 CDD:188981 29/64 (45%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.