DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ph-d and samd1a

DIOPT Version :9

Sequence 1:NP_524794.2 Gene:ph-d / 44889 FlyBaseID:FBgn0004860 Length:1537 Species:Drosophila melanogaster
Sequence 2:NP_001303918.1 Gene:samd1a / 768149 ZFINID:ZDB-GENE-061013-517 Length:377 Species:Danio rerio


Alignment Length:254 Identity:58/254 - (22%)
Similarity:89/254 - (35%) Gaps:98/254 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly  1362 VDAMALVDRLDE----AMAEEKMQTESYQTVSDALPIQAATPEVPPISMPVLAAMSTSSPLSLPL 1422
            ||...:.|..||    |..:..|..|..::..||:..|:....  .|||..:.:.:||.||..|.
Zfish   105 VDEDHMEDMEDEMSTTAGMDSSMDEEGDESSLDAMCAQSTADS--GISMSPITSSNTSLPLPSPT 167

  Fly  1423 T-----------------LPLPIAIAPT----------------VSLPV--VSAGV--------- 1443
            :                 ..||..:.|:                :.|||  |..|:         
Zfish   168 SSKNSPTHDDLRQEADSAYTLPEHMQPSGQQDTGCVVLVQQPQAICLPVLKVEDGLQAEESTLTH 232

  Fly  1444 ----------------------------------------VAPVLAIPSSNI-NGSD--RPPISS 1465
                                                    ||....|.|..| ||:|  :..||.
Zfish   233 DELMSERTVTLDEAVKSDGGSHAVSDHTEEGEICNKESKSVAEEETINSGEINNGNDVIKEEISQ 297

  Fly  1466 ----WSVEEVSNFIRELPGCQDYVDDFIQQEIDGQALLLLKENHLVNAMGMKLGPALKI 1520
                |||.:|:.:...: |..:....|..|||||::|||::.:.::..:.::|||||||
Zfish   298 DPLLWSVADVARYFTSV-GFPEQALAFRTQEIDGKSLLLMQRSDVLTGLSIRLGPALKI 355

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ph-dNP_524794.2 SAM_Ph1,2,3 1461..1529 CDD:188976 23/64 (36%)
SAM 1464..1529 CDD:197735 22/61 (36%)
samd1aNP_001303918.1 SAM_Atherin-like 299..367 CDD:188982 21/58 (36%)
SAM 299..355 CDD:197735 19/56 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.