DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ph-d and SCML1

DIOPT Version :9

Sequence 1:NP_524794.2 Gene:ph-d / 44889 FlyBaseID:FBgn0004860 Length:1537 Species:Drosophila melanogaster
Sequence 2:XP_005274635.1 Gene:SCML1 / 6322 HGNCID:10580 Length:330 Species:Homo sapiens


Alignment Length:168 Identity:56/168 - (33%)
Similarity:76/168 - (45%) Gaps:27/168 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly  1383 ESYQTVS-DALPIQAATPEVPPI---------SMPVLAAMSTSSPLSLPLTLPLPIA--IAPTVS 1435
            |.||... :..||.:.||.  |:         ..|..|:...:...|..|.|..|.|  |..|.|
Human   163 EEYQRAELEEDPILSRTPS--PVHPSDFSEHNCQPYYASDGATYGSSSGLCLGNPRADSIHNTYS 225

  Fly  1436 LPVVSAGVVAP--VLAIPSSN----INGSDRPPISSWSVEEVSNFIRE---LPGCQDYVDDFIQQ 1491
            ....||   ||  |...|..|    ..||.....|:||||.|..|:::   |..| ..||.|...
Human   226 TDHASA---APPSVTRSPVENDGYIEEGSITKHPSTWSVEAVVLFLKQTDPLALC-PLVDLFRSH 286

  Fly  1492 EIDGQALLLLKENHLVNAMGMKLGPALKIVAKVESIKE 1529
            ||||:|||||..:.|:..:|:|||.|:|:...::.:|:
Human   287 EIDGKALLLLTSDVLLKHLGVKLGTAVKLCYYIDRLKQ 324

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ph-dNP_524794.2 SAM_Ph1,2,3 1461..1529 CDD:188976 28/70 (40%)
SAM 1464..1529 CDD:197735 28/67 (42%)
SCML1XP_005274635.1 SAM_Scm 253..324 CDD:188977 28/71 (39%)
SAM 256..324 CDD:197735 28/68 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S8350
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.950

Return to query results.
Submit another query.