DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ph-d and l3mbtl1b

DIOPT Version :9

Sequence 1:NP_524794.2 Gene:ph-d / 44889 FlyBaseID:FBgn0004860 Length:1537 Species:Drosophila melanogaster
Sequence 2:XP_009290632.1 Gene:l3mbtl1b / 559572 ZFINID:ZDB-GENE-100922-38 Length:786 Species:Danio rerio


Alignment Length:262 Identity:67/262 - (25%)
Similarity:106/262 - (40%) Gaps:63/262 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly  1316 CGKMEHKAKLKRKRYCSP-----GCSRQAKNGIGGV-----GSGET-------------NGLGTG 1357
            |.|..|..:.......||     ||.....||:|.:     |:..|             :||...
Zfish   534 CQKTGHPLQHPNGTRDSPVPPGQGCPTPGCNGVGHIRGPRYGTHYTAVSCPYSDLNFNKDGLVPD 598

  Fly  1358 GIVGVDAMALVDRLDEAMAEEKMQTESYQTVSDALPIQAATPEVPPISMPVLAAMSTSSPLSLPL 1422
            .:.|...:.:........||...||  :|..|     .|:|||.|..:       :.:.|.:.|:
Zfish   599 RLSGERPVTISGPPRHRRAETLTQT--HQPTS-----SASTPEPPDTT-------TDACPQARPV 649

  Fly  1423 TLPLPIAIAP-TVSLPVVSA---GVVAPVLAIPSSNINGSDRP---------------------- 1461
            ...:..|.|| .|..|.|..   |..:....:..|...|.::|                      
Zfish   650 REHVVTAAAPKCVKAPQVKQEGDGKDSLQQFLHESVFCGWEQPRFQLCWEKHGKLLPEALGLTAK 714

  Fly  1462 PISSWSVEEVSNFIRELPGCQDYVDDFIQQEIDGQALLLLKENHLVNAMGMKLGPALKIVAKVES 1526
            .:|.|:.|||::|:|.||||:::...|.:::|||:|.|||.::.:|..:.:||||||||...:..
Zfish   715 RVSKWNTEEVASFVRGLPGCREHAPTFRKEQIDGEAFLLLTQSDIVKILSIKLGPALKIYNSILM 779

  Fly  1527 IK 1528
            :|
Zfish   780 LK 781

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ph-dNP_524794.2 SAM_Ph1,2,3 1461..1529 CDD:188976 30/90 (33%)
SAM 1464..1529 CDD:197735 29/65 (45%)
l3mbtl1bXP_009290632.1 MBT 238..333 CDD:214723
MBT 346..440 CDD:214723
MBT 452..544 CDD:214723 3/9 (33%)
zf-C2HC 557..584 CDD:279824 7/26 (27%)
SAM_Scm-like-3MBT3,4 716..781 CDD:188981 28/64 (44%)
SAM 716..781 CDD:197735 28/64 (44%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.