DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ph-d and SAMD7

DIOPT Version :9

Sequence 1:NP_524794.2 Gene:ph-d / 44889 FlyBaseID:FBgn0004860 Length:1537 Species:Drosophila melanogaster
Sequence 2:NP_001291295.1 Gene:SAMD7 / 344658 HGNCID:25394 Length:446 Species:Homo sapiens


Alignment Length:282 Identity:68/282 - (24%)
Similarity:103/282 - (36%) Gaps:101/282 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly  1246 KAMIKPNVL--THVIDGFIIQEANEPFPVTRQRYA-DKDVSDEPPKKKATMQEDIKLSGIASAPG 1307
            |:..:..:|  ||.:            |.....|| |.|: :.|..:|::...:...:.:|:.  
Human   202 KSQAEEKILGQTHAV------------PYEEDHYAKDPDI-EAPSNQKSSETNEKPTTALANT-- 251

  Fly  1308 SDMVACEQCGKMEHKAKLKRKRYCSPGCSRQAKNGIGGVGSGETNGLGTGGIVGVDAMALVDRLD 1372
                    ||::|   ...||.:.|...:.:||....|                           
Human   252 --------CGELE---PTHRKPWGSHTTTLKAKAWDDG--------------------------- 278

  Fly  1373 EAMAEEKMQTESYQTVSDALPIQAATPEVPPISMPVLAAMSTSSPLSLPLTLPLPIAIAPTVSLP 1437
                :|:...:.:.|..:...:      .||:..|           |||.|..| :.|...:||.
Human   279 ----KEEASEQIFATCDEKNGV------CPPVPRP-----------SLPGTHAL-VTIGGNLSLD 321

  Fly  1438 VVSAGVVAPVLAIPSSNINGSDRPPISSWSVEEVSNFIRELPGCQDYVDDFIQQEIDGQALLLLK 1502
                                   ..|..|:|::|.:|||.||||.||...|....|||:.|.||.
Human   322 -----------------------EDIQKWTVDDVHSFIRSLPGCSDYAQVFKDHAIDGETLPLLT 363

  Fly  1503 ENHLVNAMGMKLGPALKIVAKV 1524
            |.||...||:||||||||.::|
Human   364 EEHLRGTMGLKLGPALKIQSQV 385

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ph-dNP_524794.2 SAM_Ph1,2,3 1461..1529 CDD:188976 34/64 (53%)
SAM 1464..1529 CDD:197735 33/61 (54%)
SAMD7NP_001291295.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 187..207 1/4 (25%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 225..277 13/65 (20%)
SAM_Samd7,11 324..391 CDD:188978 34/62 (55%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12247
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.