DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ph-d and Samd7

DIOPT Version :9

Sequence 1:NP_524794.2 Gene:ph-d / 44889 FlyBaseID:FBgn0004860 Length:1537 Species:Drosophila melanogaster
Sequence 2:NP_001178632.1 Gene:Samd7 / 310257 RGDID:1308931 Length:445 Species:Rattus norvegicus


Alignment Length:361 Identity:82/361 - (22%)
Similarity:129/361 - (35%) Gaps:116/361 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly  1263 IQEANEPFPVTRQRYADKDVSDEPPKKKATMQEDIKLSGIASAPGSDMVACEQCGKMEHKAKLKR 1327
            :..||.|.|:....|:...:....|.|..|.:.::.....|:....:|.:..|..:||       
  Rat    59 LPSANTPNPLPGHFYSGWGILPPEPIKAVTTRNEMFERHHAARAEMEMYSLYQQRRME------- 116

  Fly  1328 KRYCSPGCSRQAKNGIGGVGSGETNGLG-TGGIVGVDAMALVDRLD------------------- 1372
                     |....|:.|:|.....|.| .||..|....:.:...|                   
  Rat   117 ---------RVNPKGLSGLGIPLFYGSGCLGGPAGFQGRSTLPASDVHVHRSTFRHLQGNPVLLA 172

  Fly  1373 ------EAMAEE-------------KMQTESYQTVSDALPIQAATPEVPP--------ISMPVLA 1410
                  |...::             ::.|||:::.:|    :.::.::|.        |..|.:.
  Rat   173 TRPHFTECWGQKYRLRRGTVYQKPPEIDTESFKSQAD----EKSSGQMPTAPYEEEEYIKDPEIG 233

  Fly  1411 AMSTSSP----------LSLPLTLPLPIAIAPTVSLPVVS-------------------AGVVAP 1446
            ..:...|          |:.|...|.|....|: |:...:                   .||..|
  Rat   234 VDNQQEPRVTDGNPTAVLANPHGEPQPNQRKPS-SMEAKAWDDGKGEPSEQGYEGCDEKNGVCLP 297

  Fly  1447 VLAIPSSNINGSDRP-------PIS---SWSVEEVSNFIRELPGCQDYVDDFIQQEIDGQALLLL 1501
            ...:|   :.|:..|       |:|   .|:|::|.||||.||||.||...|....|||:.|.||
  Rat   298 ASTLP---LPGTQEPVALQENRPLSDIHKWTVDDVYNFIRSLPGCSDYAQVFKDHAIDGETLPLL 359

  Fly  1502 KENHLVNAMGMKLGPALKIVAKVES------IKEVP 1531
            .|.||...||:||||||||.::|..      .|::|
  Rat   360 TEQHLRGTMGLKLGPALKIQSQVSQHVGNMFCKKLP 395

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ph-dNP_524794.2 SAM_Ph1,2,3 1461..1529 CDD:188976 37/83 (45%)
SAM 1464..1529 CDD:197735 35/73 (48%)
Samd7NP_001178632.1 SAM_Samd7,11 321..388 CDD:188978 34/66 (52%)
SAM 322..384 CDD:197735 34/61 (56%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12247
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.