DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ph-d and L3mbtl3

DIOPT Version :9

Sequence 1:NP_524794.2 Gene:ph-d / 44889 FlyBaseID:FBgn0004860 Length:1537 Species:Drosophila melanogaster
Sequence 2:XP_003748714.1 Gene:L3mbtl3 / 309550 RGDID:1305474 Length:868 Species:Rattus norvegicus


Alignment Length:333 Identity:78/333 - (23%)
Similarity:123/333 - (36%) Gaps:98/333 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly  1216 TTSSGTFTTSCTSTTTTTTSS-------ISNGSKDLPKAMIKPNVLTHVIDGFIIQEANEPFPVT 1273
            |.||.:|..|..:.|..::||       .:|..:|..|.  |.|.:....:..:::|  ||.|..
  Rat   604 TPSSFSFPRSKRTDTNESSSSPETRDQHANNVKEDSEKK--KENEVKTSAEAKVVRE--EPTPSV 664

  Fly  1274 RQRYADKDVSDEPPKK--KATMQEDIKLSGIASAPGSDMVACEQCGKMEHKAKLKRKRYCSPGCS 1336
            :|        .:||::  ||.....|:       |........|....:.:|:..::...:|   
  Rat   665 QQ--------TQPPQQALKAPQAPQIQ-------PAQQAPQAPQAQPTQQQAQQAQQAPQAP--- 711

  Fly  1337 RQAKNGIGGVGSGETNGLGTGGIVGVDAMALVDRLDEAMAEEKMQTE-SYQTVSDALPIQAATPE 1400
             ||:                                  .|.:..||. :.|....|.|.|....:
  Rat   712 -QAQ----------------------------------PAPQAPQTHPTQQQAQQAQPTQQQAQQ 741

  Fly  1401 VPPISMP---------VLAAMSTSSPL-SLPLTLPLPIAIAPTVSLPVVSAGVVAPVLAIPSSNI 1455
            ..|....         ....:|...|: .|||.......:.|||:             .||:|. 
  Rat   742 AQPTQQQQAQQQAQRRSAVFLSFKPPIPCLPLRWEQQSKLLPTVA-------------GIPASR- 792

  Fly  1456 NGSDRPPISSWSVEEVSNFIRELPGCQDYVDDFIQQEIDGQALLLLKENHLVNAMGMKLGPALKI 1520
                   :|.||.:|||.||:.||||:::...|..::|||:|.||:.:..:|..|.:||||||||
  Rat   793 -------VSKWSTDEVSEFIQSLPGCEEHGKVFKDEQIDGEAFLLMTQTDIVKIMSIKLGPALKI 850

  Fly  1521 VAKVESIK 1528
            ...:...|
  Rat   851 FNSILMFK 858

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ph-dNP_524794.2 SAM_Ph1,2,3 1461..1529 CDD:188976 30/68 (44%)
SAM 1464..1529 CDD:197735 30/65 (46%)
L3mbtl3XP_003748714.1 MBT 235..331 CDD:214723
MBT 342..438 CDD:214723
MBT 450..542 CDD:214723
SAM_Scm-like-3MBT3,4 793..858 CDD:188981 29/64 (45%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.