DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ph-d and SAMD13

DIOPT Version :9

Sequence 1:NP_524794.2 Gene:ph-d / 44889 FlyBaseID:FBgn0004860 Length:1537 Species:Drosophila melanogaster
Sequence 2:XP_016855866.1 Gene:SAMD13 / 148418 HGNCID:24582 Length:122 Species:Homo sapiens


Alignment Length:86 Identity:33/86 - (38%)
Similarity:51/86 - (59%) Gaps:12/86 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly  1446 PVLAIPSSN-INGS---------DRPP-ISSWSVEEVSNFIRELPGCQDYVDDFIQQEIDGQALL 1499
            |:|::...| .|||         .||| .:.|:|.:|.|:.|.: |.::....|.:|||||::||
Human    20 PMLSVDMENKENGSVGVKNSMENGRPPDPADWAVMDVVNYFRTV-GFEEQASAFQEQEIDGKSLL 83

  Fly  1500 LLKENHLVNAMGMKLGPALKI 1520
            |:..|.::..:.:||||||||
Human    84 LMTRNDVLTGLQLKLGPALKI 104

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ph-dNP_524794.2 SAM_Ph1,2,3 1461..1529 CDD:188976 26/61 (43%)
SAM 1464..1529 CDD:197735 24/57 (42%)
SAMD13XP_016855866.1 SAM_Atherin-like 48..116 CDD:188982 24/58 (41%)
SAM 48..104 CDD:197735 22/56 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.