DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mdy and D1022.3

DIOPT Version :9

Sequence 1:NP_609813.1 Gene:mdy / 44887 FlyBaseID:FBgn0004797 Length:565 Species:Drosophila melanogaster
Sequence 2:NP_495560.1 Gene:D1022.3 / 183900 WormBaseID:WBGene00017022 Length:245 Species:Caenorhabditis elegans


Alignment Length:204 Identity:39/204 - (19%)
Similarity:65/204 - (31%) Gaps:74/204 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 NKDPQDKEPGKAEQPTKNSGSSGVGIMKRLRRSASATEHNLSSLRNRKSTQNLFDQHGNPI---D 65
            :.|...|.||....|    ...||..::..|....|.||...:|        :.|.:|..|   |
 Worm    25 SSDNSTKHPGVLIFP----AFRGVSKLEIARAKLLAEEHGYVAL--------VADIYGKGIRCTD 77

  Fly    66 LRQ---YRKVLDKDENGNGTNGSEKKLRYRRTQSVTRAEEISNKEEKQRRAQPGRPIHRPRDSLF 127
            :..   ..:.:..|.||        ||:.|...::...:.:...::::..|              
 Worm    78 ISSAVTLLRPMTSDRNG--------KLKPRLEAALNALKSVPCVDKQKLGA-------------- 120

  Fly   128 SWSSGFTNFSGLVNWGFLLLCIGGL--------RL-GLENLLKY--------GIRINPLDWFFFI 175
                          :||   |||||        |. |:..::.:        ||.:..||..|..
 Worm   121 --------------FGF---CIGGLCSLDCARYRFDGIRAVISFHGTLTPIEGIPLEQLDDIFIQ 168

  Fly   176 SGHNEGEGH 184
            ..|.:.:.|
 Worm   169 VHHGDADAH 177

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mdyNP_609813.1 MBOAT 115..545 CDD:294479 16/87 (18%)
D1022.3NP_495560.1 Abhydrolase 31..242 CDD:389770 38/198 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1275897at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.