DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mys and itgbl1

DIOPT Version :9

Sequence 1:NP_001284997.1 Gene:mys / 44885 FlyBaseID:FBgn0004657 Length:846 Species:Drosophila melanogaster
Sequence 2:NP_001019243.1 Gene:itgbl1 / 554050 ZFINID:ZDB-GENE-050522-410 Length:428 Species:Danio rerio


Alignment Length:353 Identity:96/353 - (27%)
Similarity:134/353 - (37%) Gaps:132/353 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly   502 LCSCPCENPGSI-GYQVQAN----------SCSGHGTSMCGICNCDDSYFGNKC----ECSATDL 551
            :|.|....||:. |.:.:.:          :|..||...||.|.||:::||..|    |||.:..
Zfish    66 ICICQVTEPGTFYGPRCECHDWVCPTYDGKTCGDHGICNCGKCFCDENWFGESCQYEEECSLSSK 130

  Fly   552 TSKFANDTSCRADSTSTTDCSGRGHCVCGACECHKRPNPIEIISGKHCECDNFSC-ERNRNQLCS 615
            |||    ..||  :.....||..|.|.||:|.|| .|:...:|||::||||:..| :.:..::|.
Zfish   131 TSK----DLCR--NAQGVVCSNAGTCHCGSCMCH-NPDGKSLISGRYCECDDSECLDEDSGEVCG 188

  Fly   616 GPDHGTCECGRCKCKPGWTGSNCGCQ------ESNDTCMPPGG---------------------- 652
            |  ||.|.||.|.|..||.|..|..|      ||...|..|.|                      
Zfish   189 G--HGKCYCGNCYCSAGWHGDKCEFQCAISPWESKRRCTSPDGKICSNRGTCVCGECTCYDVDPS 251

  Fly   653 ---GEI-----------------------CSGHGTCECGVCKCTVNDQGRFSGRHCE-------- 683
               |:|                       |||||.|.||.|.|   .:| ::||.|:        
Zfish   252 GDWGDIHGETCECDERSCHAMYDRYSDDFCSGHGQCNCGRCDC---KEG-WAGRKCDHPLSCSLS 312

  Fly   684 ------KCP-----TCSGRCQELKDCVQCQMYKTGELK-NGDDCARNCTQFVPVGVEKVEIDETK 736
                  ||.     .|.||.|.|  |.||..:..|:.: :|.:|  .|                 
Zfish   313 VEASQKKCRGTSSLPCFGRGQCL--CGQCTCHPPGDKRVHGKNC--EC----------------- 356

  Fly   737 DEQMCKFFDEDDCKFMFKYSEQGELHVY 764
            |::.|:..:.:.|        .|:.|.:
Zfish   357 DDRQCEDLNGEIC--------GGKTHTH 376

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mysNP_001284997.1 INB 45..505 CDD:197563 1/2 (50%)
Integrin_B_tail 692..773 CDD:285239 14/74 (19%)
Integrin_b_cyt 803..843 CDD:285884
itgbl1NP_001019243.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170581965
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1226
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10082
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.840

Return to query results.
Submit another query.