DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mys and Itgbl1

DIOPT Version :9

Sequence 1:NP_001284997.1 Gene:mys / 44885 FlyBaseID:FBgn0004657 Length:846 Species:Drosophila melanogaster
Sequence 2:NP_663442.2 Gene:Itgbl1 / 223272 MGIID:2443439 Length:494 Species:Mus musculus


Alignment Length:412 Identity:110/412 - (26%)
Similarity:141/412 - (34%) Gaps:167/412 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly   436 TYF----------------SSCLSNGP-EVQTSKCDNLKEGQQVSFTAQIQLLKCPEDPRDWTQT 483
            |||                .:|..:|. :....|||....|:...:..     ||     |.|:.
Mouse    83 TYFGPLCECHEWICETYDGKTCAGHGNCDCGKCKCDVGWSGEACQYPT-----KC-----DLTKK 137

  Fly   484 IHISPVGINEVMQIQLTMLCS---------CPCENPGSIGY---------------QVQANSCSG 524
            |.      |::.:....::||         |.|:|....|.               ......|.|
Mouse   138 IS------NQMCKNSQDVICSNAGTCHCGRCKCDNSDGHGLIYGKFCECDDRECIDDETEEVCGG 196

  Fly   525 HGTSMCGICNCDDSYFGNKCE--CSATDLTSKFANDTSCRADSTSTTDCSGRGHCVCGACECHKR 587
            ||...||.|.|:..:.|:|||  |..|...||      .|..|.....||.||.||||.|.||  
Mouse   197 HGKCYCGNCYCEAGWHGDKCEFQCDITPWESK------RRCTSPDGKVCSNRGTCVCGECSCH-- 253

  Fly   588 PNPIEI--------ISGKHCECDNFSC----ERNRNQLCSGPDHGTCECGRCKCKPGWTGSNC-- 638
                ::        |.|..||||...|    :|..:..|||  ||.|.||||.|:.||.|..|  
Mouse   254 ----DVDPTGDWGDIHGDTCECDERDCRAVYDRYSDDFCSG--HGQCNCGRCDCRAGWYGKKCEH 312

  Fly   639 -------------GCQESND--------------TCMPPG-------------------GGEICS 657
                         .||.|:|              ||.|||                   .|.:|.
Mouse   313 PRNCPLSAEESTKKCQGSSDLPCSGRGRCECGRCTCYPPGDSRVYGKTCECDDRRCEDLDGVVCG 377

  Fly   658 GHGTCECGVCKCTVNDQGRFSG--RHCEKC----------------PTCSGR--CQELKDCVQC- 701
            |||.|.||.|.|   ::|.|..  :|..||                ..|||:  |.    |.:| 
Mouse   378 GHGMCSCGRCVC---EKGWFGKLCQHLRKCNMTEEQSRSLCESADGTLCSGKGSCH----CGKCI 435

  Fly   702 ----QMYKTGELKNGDDCARNC 719
                :.|.:||..:.||  |:|
Mouse   436 CSGEEWYISGEFCDCDD--RDC 455

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mysNP_001284997.1 INB 45..505 CDD:197563 17/94 (18%)
Integrin_B_tail 692..773 CDD:285239 10/33 (30%)
Integrin_b_cyt 803..843 CDD:285884
Itgbl1NP_663442.2 Cysteine-rich tandem repeats 51..494 110/412 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167838140
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1226
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10082
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.