DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rhi and Skadu

DIOPT Version :10

Sequence 1:NP_536794.1 Gene:rhi / 44879 FlyBaseID:FBgn0004400 Length:418 Species:Drosophila melanogaster
Sequence 2:NP_001162985.1 Gene:Skadu / 8673966 FlyBaseID:FBgn0259922 Length:133 Species:Drosophila melanogaster


Alignment Length:97 Identity:22/97 - (22%)
Similarity:34/97 - (35%) Gaps:25/97 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   159 TSQVSTDSTEVFDGNPSATTTNMIKSPRIQSLFSDLNLIEPTKDKDVGDTSLKTPP--------- 214
            |..:||.|       |.:|....:|.| ::...|||..:.|....|..:...:...         
  Fly    23 TCNLSTIS-------PRSTLVQTVKKP-VKKFSSDLANLPPVPAIDAFERGYQVESILDMVQNIH 79

  Fly   215 -------KSRRLIEFPQREDAPLSSKHVSPML 239
                   |...||| |:.....|:.:||..:|
  Fly    80 KEQFLYIKFTNLIE-PELVPLELALQHVPHLL 110

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rhiNP_536794.1 CD_Rhino 23..73 CDD:349280
CSD 362..411 CDD:349275
SkaduNP_001162985.1 CSD 66..116 CDD:349275 9/46 (20%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.