DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rhi and cbx3a

DIOPT Version :9

Sequence 1:NP_536794.1 Gene:rhi / 44879 FlyBaseID:FBgn0004400 Length:418 Species:Drosophila melanogaster
Sequence 2:XP_005173826.1 Gene:cbx3a / 751689 ZFINID:ZDB-GENE-030131-1158 Length:177 Species:Danio rerio


Alignment Length:120 Identity:39/120 - (32%)
Similarity:62/120 - (51%) Gaps:13/120 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 NLGLVDAPPN----DHVEEYVVEKILGKRFVNGRPQVLVKWSGFPNENNTWEPLENVGNCMKLVS 69
            |:|...|..:    ..:||:||||::.:|.|||:.:..:||.||.:.:|||||.||: :|.:|::
Zfish     3 NMGKKQAGKSKKEVQEIEEFVVEKVMDQRVVNGKVEFFLKWKGFTDADNTWEPEENL-DCPELIA 66

  Fly    70 DF-ESEVFRLHRKAAAKSVGKSKSSPSSSGPLITENGPSSSKKTQQHSKSVQAKN 123
            .| ||:...:.:..|.|       ..||:....||...:..||.........|:|
Zfish    67 AFLESQKGVVEKPEAVK-------RKSSTDEPETEESKAKRKKEMSDKPRGFARN 114

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rhiNP_536794.1 CHROMO 22..72 CDD:237991 24/50 (48%)
ChSh 357..411 CDD:294039
cbx3aXP_005173826.1 Chromo 23..71 CDD:278797 22/48 (46%)
Chromo_shadow 116..167 CDD:279701
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1628171at2759
OrthoFinder 1 1.000 - - FOG0000191
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.