DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rhi and CBX8

DIOPT Version :9

Sequence 1:NP_536794.1 Gene:rhi / 44879 FlyBaseID:FBgn0004400 Length:418 Species:Drosophila melanogaster
Sequence 2:NP_065700.1 Gene:CBX8 / 57332 HGNCID:15962 Length:389 Species:Homo sapiens


Alignment Length:393 Identity:74/393 - (18%)
Similarity:127/393 - (32%) Gaps:145/393 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 YVVEKILGKRFVNGRPQVLVKWSGFPNENNTWEPLENVGNCMKLVSDFES--------------- 73
            :..|.:|.:|...||.:.||||.|:..:.:||||.||:.:. :|::.||.               
Human    11 FAAEALLKRRIRKGRMEYLVKWKGWSQKYSTWEPEENILDA-RLLAAFEEREREMELYGPKKRGP 74

  Fly    74 --EVFRLHRKAAAKSVGKSKSSPSSSGPLITENG-----------------------PSSSKKT- 112
              :.|.|..:|.||:......|.|:.|..|...|                       |:||..| 
Human    75 KPKTFLLKAQAKAKAKTYEFRSDSARGIRIPYPGRSPQDLASTSRAREGLRNMGLSPPASSTSTS 139

  Fly   113 ----------------------------QQHSKSVQAKNTAGMSKMNQK---KGKNIKKTAGKIK 146
                                        ::..:..:.:...|.|:::.|   .|.:.||...|  
Human   140 STCRAEAPRDRDRDRDRDRERDRERERERERERERERERERGTSRVDDKPSSPGDSSKKRGPK-- 202

  Fly   147 DIENYPKTQMPSTSQVSTDSTEVFDGNPSATTTNMIKSPRIQSLFSDLNLIEPTKDKDVGDTSLK 211
                 |:.::|..||...       |.|||.....:|..::..                      
Human   203 -----PRKELPDPSQRPL-------GEPSAGLGEYLKGRKLDD---------------------- 233

  Fly   212 TP------PKSRRLIEFPQREDAPLSSKHVSPMLIRKESQPLQSSCTDDSDLGESSSSMSLPTVS 270
            ||      |....:|:..:|:|:.|                :|...|..|. .|::..:::.|..
Human   234 TPSGAGKFPAGHSVIQLARRQDSDL----------------VQCGVTSPSS-AEATGKLAVDTFP 281

  Fly   271 STSSEKSIKVTKSEPKTLGQIKFSSRSSDGGHAASSLGAPKEG-----DIGLDLSGSDSMDSEVE 330
            :    :.||...:..:..||   .:...:|.......|.|..|     |:|.. .|..|:.:.:.
Human   282 A----RVIKHRAAFLEAKGQ---GALDPNGTRVRHGSGPPSSGGGLYRDMGAQ-GGRPSLIARIP 338

  Fly   331 SMR 333
            ..|
Human   339 VAR 341

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rhiNP_536794.1 CHROMO 22..72 CDD:237991 17/47 (36%)
ChSh 357..411 CDD:294039
CBX8NP_065700.1 CHROMO 10..62 CDD:214605 19/51 (37%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 124..241 22/152 (14%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 298..327 6/28 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1628171at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.