DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment rhi and cbx3b

DIOPT Version :9

Sequence 1:	NP_536794.1	Gene:	rhi / 44879	FlyBaseID:	FBgn0004400	Length:	418	Species:	Drosophila melanogaster
Sequence 2:	NP_001373276.1	Gene:	cbx3b / 567497	ZFINID:	ZDB-GENE-070628-2	Length:	194	Species:	Danio rerio

Alignment Length:	51	Identity:	21/51 - (41%)
Similarity:	36/51 - (70%)	Gaps:	1/51 - (1%)

- Green bases have known domain annotations that are detailed below.

  Fly    21 VEEYVVEKILGKRFVNGRPQVLVKWSGFPNENNTWEPLENVGNCMKLVSDF 71
            |:|:.||||:.:|..||:.:..:||.||.:..|||||.:|: :|.:|:.::
Zfish    18 VQEFAVEKIIRRRVNNGKVEYYLKWKGFTDAENTWEPEDNL-DCPELIEEY 67

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
rhi	NP_536794.1	CHROMO	22..72	CDD:237991	20/50 (40%)
rhi	NP_536794.1	ChSh	357..411	CDD:294039
cbx3b	NP_001373276.1	CD_CSD	20..68	CDD:421697	20/49 (41%)
cbx3b	NP_001373276.1	Chromo_shadow	136..188	CDD:396116
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_KOG1911
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	1	1.010	-	-		D1628171at2759
OrthoFinder	1	1.000	-	-		FOG0000191
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	1	1.000	-	-
TreeFam	0	0.000	Not matched by this tool.
ZFIN	0	0.000	Not matched by this tool.
	5	4.820