powered by:
Protein Alignment rhi and cbx3b
DIOPT Version :9
Sequence 1: | NP_536794.1 |
Gene: | rhi / 44879 |
FlyBaseID: | FBgn0004400 |
Length: | 418 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001373276.1 |
Gene: | cbx3b / 567497 |
ZFINID: | ZDB-GENE-070628-2 |
Length: | 194 |
Species: | Danio rerio |
Alignment Length: | 51 |
Identity: | 21/51 - (41%) |
Similarity: | 36/51 - (70%) |
Gaps: | 1/51 - (1%) |
- Green bases have known domain annotations that are detailed below.
Fly 21 VEEYVVEKILGKRFVNGRPQVLVKWSGFPNENNTWEPLENVGNCMKLVSDF 71
|:|:.||||:.:|..||:.:..:||.||.:..|||||.:|: :|.:|:.::
Zfish 18 VQEFAVEKIIRRRVNNGKVEYYLKWKGFTDAENTWEPEDNL-DCPELIEEY 67
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_KOG1911 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
1 |
1.010 |
- |
- |
|
D1628171at2759 |
OrthoFinder |
1 |
1.000 |
- |
- |
|
FOG0000191 |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
1 |
1.000 |
- |
- |
|
|
TreeFam |
0 | 0.000 |
Not matched by this tool. |
ZFIN |
0 | 0.000 |
Not matched by this tool. |
|
5 | 4.820 |
|
Return to query results.
Submit another query.