DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rhi and cbx5

DIOPT Version :9

Sequence 1:NP_536794.1 Gene:rhi / 44879 FlyBaseID:FBgn0004400 Length:418 Species:Drosophila melanogaster
Sequence 2:NP_001073653.1 Gene:cbx5 / 563396 ZFINID:ZDB-GENE-030131-5553 Length:204 Species:Danio rerio


Alignment Length:200 Identity:60/200 - (30%)
Similarity:89/200 - (44%) Gaps:45/200 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 DAPPNDHVEEYVVEKILGKRFVNGRPQVLVKWSGFPNENNTWEPLENVGNCMKLVSDFESEVFRL 78
            |...:...|||||||:|.:|.|.||.:..:||.||..::|||||.:|: :|.:|:|:|    .:.
Zfish    11 DEAASSDEEEYVVEKVLDRRVVKGRVEYFLKWKGFTEKHNTWEPEKNL-DCPELISEF----MKT 70

  Fly    79 HRKAAAKSVGKSKSS---PSSSGPLITENGPSSSKKTQQHSKSVQAKNTAGMSKMNQKKGKNIKK 140
            ::|..:.|...||||   |||:.|..:....|:||:     |:.:.:| ...||..:||...|..
Zfish    71 YKKGNSASPPSSKSSSTGPSSARPKDSSGSSSTSKR-----KNSEEEN-GSSSKPKKKKEDEILV 129

  Fly   141 TAGKIKDIENYPKTQMPSTSQVSTDSTEVFDGNPSATTTNMIKSPRIQSLFSDLNLIEPTKDKDV 205
            ..|..:.:|       |.....:|||.                        .||..:...||.|.
Zfish   130 ARGFERGLE-------PEKIIGATDSC------------------------GDLMFLMKWKDSDE 163

  Fly   206 GDTSL 210
            .|..|
Zfish   164 ADLVL 168

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rhiNP_536794.1 CHROMO 22..72 CDD:237991 25/49 (51%)
ChSh 357..411 CDD:294039
cbx5NP_001073653.1 Chromo 21..69 CDD:306815 24/52 (46%)
Chromo_shadow 138..190 CDD:307518 11/61 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1628171at2759
OrthoFinder 1 1.000 - - FOG0000191
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22812
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
55.020

Return to query results.
Submit another query.