DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rhi and cbx7a

DIOPT Version :9

Sequence 1:NP_536794.1 Gene:rhi / 44879 FlyBaseID:FBgn0004400 Length:418 Species:Drosophila melanogaster
Sequence 2:NP_001017853.1 Gene:cbx7a / 550551 ZFINID:ZDB-GENE-050417-400 Length:393 Species:Danio rerio


Alignment Length:395 Identity:79/395 - (20%)
Similarity:137/395 - (34%) Gaps:142/395 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 YVVEKILGKRFVNGRPQVLVKWSGFPNENNTWEPLENVGNCMKLVSDFESEVFRLHRKAAAKSVG 88
            :.||.|..||...|..:.|:||.|:..:.:||||.:|:.: .:||..||.:..: .|..|.|..|
Zfish    11 FAVESITKKRIRKGNVEYLLKWQGWSPKYSTWEPEDNILD-PRLVLAFEEKAEK-DRALAYKKKG 73

  Fly    89 ----------------------KSKSSP----SSSGPLITE------------------------ 103
                                  ..|.||    |.:..:.||                        
Zfish    74 LRPRQVILRNIYPMDLRSAHKVPDKPSPRIRLSLTRSMSTEVDQNRRRYRDSVVYRRLKNRYKNR 138

  Fly   104 -------NGPSSSKKTQQHSKSVQAKNTAGMSKMNQKKGKNIKKTAGKIKDIENYPKTQMPSTSQ 161
                   .|...||:..:|  .:.||:....:....::.:.:||..   ||.||        |:|
Zfish   139 QCRSRLFEGIKPSKQPMRH--PLPAKDCTENAWNEDEQKRKVKKMR---KDEEN--------TTQ 190

  Fly   162 VSTD---STEVFDG-NPSATTTNMI---KSPRIQSLFSDLNLIEPTKDKDVGDTSLKTPPKSRRL 219
            |..|   ..|:.:| |.||...:.|   :.....|:|..    |....:|.| |::..|..    
Zfish   191 VHQDIPSGQEMSEGYNSSAEQESEITIKEDENCSSIFDQ----EEKPSEDTG-TAIGAPES---- 246

  Fly   220 IEFPQREDAPLSSKHVSPMLIRKESQPLQSSCTDDSDLGESSSSMSLPTVSSTSSEKSI-KVTKS 283
                            |.:...::::|:.::..|:..:..|.        .:|::::|: |.|||
Zfish   247 ----------------STITDTEKNEPVTNTAGDEDCVWVSH--------DTTNTDQSLHKCTKS 287

  Fly   284 ------------EPKTLGQIKFSSRSS-----DGGHAASSLGAPKEGDIGLDLSGSDSMDSEVES 331
                        .|..: :::.|:...     :.....||....|||           :|:||.:
Zfish   288 GAEEGVFDRVQNRPSVI-EVRLSATCGQEEVRESAEVGSSEAKDKEG-----------IDAEVTA 340

  Fly   332 MRRCP 336
            ..:.|
Zfish   341 EFQVP 345

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rhiNP_536794.1 CHROMO 22..72 CDD:237991 17/47 (36%)
ChSh 357..411 CDD:294039
cbx7aNP_001017853.1 CHROMO 10..62 CDD:214605 19/51 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1628171at2759
OrthoFinder 1 1.000 - - FOG0000191
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.