DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rhi and Cbx7

DIOPT Version :9

Sequence 1:NP_536794.1 Gene:rhi / 44879 FlyBaseID:FBgn0004400 Length:418 Species:Drosophila melanogaster
Sequence 2:XP_006521207.1 Gene:Cbx7 / 52609 MGIID:1196439 Length:251 Species:Mus musculus


Alignment Length:239 Identity:44/239 - (18%)
Similarity:85/239 - (35%) Gaps:68/239 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 YVVEKILGKRFVNGRPQVLVKWSGFPNENNTWEPLENVGNCMKLVSDFESE-------------- 74
            :.||.|..||...|:.:.||||.|:|.:.:||||.|::.: .:||..:|.:              
Mouse    11 FAVESIRKKRVRKGKVEYLVKWKGWPPKYSTWEPEEHILD-PRLVMAYEEKEERDRASGYRKRGP 74

  Fly    75 ---------VFRLHRKAAAKSVGKSKSSPSSSGPL---------------ITENGP--------- 106
                     ::.:..:::.|:.|..|...|.:.||               :.|.||         
Mouse    75 KPRRLLLQRLYSMDLRSSHKAKGNEKLCFSLARPLRSGSPMGVVKAGVAELVEKGPLVPTLPFPL 139

  Fly   107 -----------SSSKKTQQHSKSVQAKNTAGMSKMNQKKGKNIKKTAGKIKDIENYPKTQM---- 156
                       .|.||.......:::.:......:.:....::.:|.|..:.:|..|:.:.    
Mouse   140 RKARKAHKYLRLSRKKFPPRGPHLESHSHRRELSLQESAAPDVVQTPGDWEPMEQAPEEEAEADL 204

  Fly   157 -----PSTSQVSTDSTEVFDGNPSATTTNMIKSPRIQSLFSDLN 195
                 |.|..:.:....|.|...::.|....::...:..|.|.|
Mouse   205 TNGPPPWTPTLPSSEVTVTDITANSVTVTFREAQAAEGFFRDRN 248

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rhiNP_536794.1 CHROMO 22..72 CDD:237991 19/47 (40%)
ChSh 357..411 CDD:294039
Cbx7XP_006521207.1 CD_Cbx7 7..62 CDD:349293 20/51 (39%)
CBX7_C 209..240 CDD:375056 5/30 (17%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1628171at2759
OrthoFinder 1 1.000 - - FOG0000191
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.