DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rhi and cbx7

DIOPT Version :10

Sequence 1:NP_536794.1 Gene:rhi / 44879 FlyBaseID:FBgn0004400 Length:418 Species:Drosophila melanogaster
Sequence 2:NP_001005071.1 Gene:cbx7 / 448638 XenbaseID:XB-GENE-942584 Length:245 Species:Xenopus tropicalis


Alignment Length:151 Identity:36/151 - (23%)
Similarity:64/151 - (42%) Gaps:59/151 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 YVVEKILGKRFVNGRPQVLVKWSGFPNENNTWEPLENVGNCMKLVSDFESE-------------- 74
            :.||.|..||...|:.:.||||.|:|.:.:||||.|::.: .:||..:|.:              
 Frog    11 FAVESIRKKRIRKGKVEYLVKWKGWPPKYSTWEPEEHILD-PRLVLAYEEKEEKERASGCRKRGP 74

  Fly    75 ---------VFRLHRKAAAKSVGKS---------------KSSPSSSGPLITENGPSSSKKTQQH 115
                     ::.:..::|.||..::               |::|:||.|              :.
 Frog    75 KPKRLLLQRLYSMDLRSAHKSKERNLCFSLSRRFNPALGGKTTPTSSVP--------------EK 125

  Fly   116 SKSVQAKNTAGMSKMNQKKGK 136
            :||:|..    :||  |:||:
 Frog   126 AKSLQFP----LSK--QRKGR 140

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rhiNP_536794.1 CD_Rhino 23..73 CDD:349280 19/48 (40%)
CSD 362..411 CDD:349275
cbx7NP_001005071.1 CD_Cbx7 7..62 CDD:349293 20/51 (39%)
CBX7_C 202..234 CDD:465385
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.