DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rhi and cbx7

DIOPT Version :9

Sequence 1:NP_536794.1 Gene:rhi / 44879 FlyBaseID:FBgn0004400 Length:418 Species:Drosophila melanogaster
Sequence 2:NP_001005071.1 Gene:cbx7 / 448638 XenbaseID:XB-GENE-942584 Length:245 Species:Xenopus tropicalis


Alignment Length:151 Identity:36/151 - (23%)
Similarity:64/151 - (42%) Gaps:59/151 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 YVVEKILGKRFVNGRPQVLVKWSGFPNENNTWEPLENVGNCMKLVSDFESE-------------- 74
            :.||.|..||...|:.:.||||.|:|.:.:||||.|::.: .:||..:|.:              
 Frog    11 FAVESIRKKRIRKGKVEYLVKWKGWPPKYSTWEPEEHILD-PRLVLAYEEKEEKERASGCRKRGP 74

  Fly    75 ---------VFRLHRKAAAKSVGKS---------------KSSPSSSGPLITENGPSSSKKTQQH 115
                     ::.:..::|.||..::               |::|:||.|              :.
 Frog    75 KPKRLLLQRLYSMDLRSAHKSKERNLCFSLSRRFNPALGGKTTPTSSVP--------------EK 125

  Fly   116 SKSVQAKNTAGMSKMNQKKGK 136
            :||:|..    :||  |:||:
 Frog   126 AKSLQFP----LSK--QRKGR 140

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rhiNP_536794.1 CHROMO 22..72 CDD:237991 19/47 (40%)
ChSh 357..411 CDD:294039
cbx7NP_001005071.1 CD_Cbx7 7..62 CDD:349293 20/51 (39%)
CBX7_C 202..234 CDD:375056
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1628171at2759
OrthoFinder 1 1.000 - - FOG0000191
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.