DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rhi and cbx1b

DIOPT Version :10

Sequence 1:NP_536794.1 Gene:rhi / 44879 FlyBaseID:FBgn0004400 Length:418 Species:Drosophila melanogaster
Sequence 2:NP_001002090.1 Gene:cbx1b / 415180 ZFINID:ZDB-GENE-040625-68 Length:203 Species:Danio rerio


Alignment Length:93 Identity:35/93 - (37%)
Similarity:55/93 - (59%) Gaps:7/93 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 QRPNLGLVDAPPNDHVEEYVVEKILGKRFVNGRPQVLVKWSGFPNENNTWEPLENVGNCMKLVSD 70
            ::.|...|:....:..|||||||:|.:|.|.|:.:.|:||.||.:|:|||||.||: :|..|:::
Zfish    30 KKQNKKKVEEVVEEEEEEYVVEKVLDRRVVKGKVEYLLKWKGFSDEDNTWEPDENL-DCPDLIAE 93

  Fly    71 FESEVFRLHRKAAAKSVGKSKSSPSSSG 98
            |      |..:..|:|.||.::.....|
Zfish    94 F------LQSQKTAESGGKRRAETDGDG 115

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rhiNP_536794.1 CD_Rhino 23..73 CDD:349280 26/49 (53%)
CSD 362..411 CDD:349275
cbx1bNP_001002090.1 CD_HP1beta_Cbx1 47..96 CDD:349297 26/55 (47%)
CSD_HP1beta_Cbx1 130..187 CDD:349301
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.