DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rhi and cbx1b

DIOPT Version :9

Sequence 1:NP_536794.1 Gene:rhi / 44879 FlyBaseID:FBgn0004400 Length:418 Species:Drosophila melanogaster
Sequence 2:NP_001002090.1 Gene:cbx1b / 415180 ZFINID:ZDB-GENE-040625-68 Length:203 Species:Danio rerio


Alignment Length:93 Identity:35/93 - (37%)
Similarity:55/93 - (59%) Gaps:7/93 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 QRPNLGLVDAPPNDHVEEYVVEKILGKRFVNGRPQVLVKWSGFPNENNTWEPLENVGNCMKLVSD 70
            ::.|...|:....:..|||||||:|.:|.|.|:.:.|:||.||.:|:|||||.||: :|..|:::
Zfish    30 KKQNKKKVEEVVEEEEEEYVVEKVLDRRVVKGKVEYLLKWKGFSDEDNTWEPDENL-DCPDLIAE 93

  Fly    71 FESEVFRLHRKAAAKSVGKSKSSPSSSG 98
            |      |..:..|:|.||.::.....|
Zfish    94 F------LQSQKTAESGGKRRAETDGDG 115

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rhiNP_536794.1 CHROMO 22..72 CDD:237991 26/49 (53%)
ChSh 357..411 CDD:294039
cbx1bNP_001002090.1 Chromo 54..97 CDD:278797 21/49 (43%)
Chromo_shadow 136..187 CDD:279701
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1911
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1628171at2759
OrthoFinder 1 1.000 - - FOG0000191
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22812
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.920

Return to query results.
Submit another query.