Sequence 1: | NP_536794.1 | Gene: | rhi / 44879 | FlyBaseID: | FBgn0004400 | Length: | 418 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_649878.1 | Gene: | HP1e / 41108 | FlyBaseID: | FBgn0037675 | Length: | 174 | Species: | Drosophila melanogaster |
Alignment Length: | 110 | Identity: | 34/110 - (30%) |
---|---|---|---|
Similarity: | 55/110 - (50%) | Gaps: | 3/110 - (2%) |
- Green bases have known domain annotations that are detailed below.
Fly 19 DHVEEYVVEKILGKRFVNGRPQVLVKWSGFPNENNTWEPLENVGNCMKLVSDFESEVFRLHRKAA 83
Fly 84 AKSVGKSKSSPSSSGPLITENGPSSSKKTQQHSKSVQAKNTAGMS 128 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
rhi | NP_536794.1 | CHROMO | 22..72 | CDD:237991 | 21/49 (43%) |
ChSh | 357..411 | CDD:294039 | |||
HP1e | NP_649878.1 | CHROMO | 25..67 | CDD:237991 | 19/42 (45%) |
Chromo_shadow | 113..164 | CDD:279701 | 6/17 (35%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG1911 | |
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 1 | 1.010 | - | - | D1628171at2759 | |
OrthoFinder | 1 | 1.000 | - | - | FOG0000191 | |
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 1 | 1.100 | - | - | P | PTHR22812 |
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
5 | 4.920 |